Page last updated: 2024-11-13

glpg0634

Description Research Excerpts Clinical Trials Roles Classes Pathways Study Profile Bioassays Related Drugs Related Conditions Protein Interactions Research Growth Market Indicators

Cross-References

ID SourceID
PubMed CID49831257
CHEMBL ID3301607
SCHEMBL ID253559
MeSH IDM0589191

Synonyms (66)

Synonym
NCGC00345855-01
filgotinib [usan:inn]
1206161-97-8
3xvl385q0m ,
glpg 0634
filgotinib ,
glpg0634
unii-3xvl385q0m
filgotinib [inn]
gs-6034 free base
g-146034
filgotinib [usan]
filgotinib [who-dd]
n-(5-(4-((1,1-oxo-.lambda.6-thiomorpholin-4-yl)methyl)phenyl((1,2,4)triazolo(1,5-a)pyridin-2-yl)cyclopropanecarboxamide
cyclopropanecarboxamide, n-(5-(4-((1,1-dioxido-4-thiomorpholinyl)methyl)phenyl)(1,2,4)triazolo(1,5-a)pyridin-2-yl)-
g146034
S7605
glpg-0634
SCHEMBL253559
CHEMBL3301607
n-[5-[4-[(1,1-dioxo-1,4-thiazinan-4-yl)methyl]phenyl]-[1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide
jyseleca
gtpl7913
HY-18300
n-(5-{4-[(1,1-dioxidothiomorpholin-4-yl)methyl]phenyl}[1,2,4]triazolo[1,5-a]pyridin-2-yl)cyclopropanecarboxamide
bdbm103727
us8563545, 1
n-(5-(4-((1,1-dioxidothiomorpholino)methyl)phenyl)-[1,2,4]triazolo[1,5-a]pyridin-2-yl)cyclopropanecarboxamide
1206101-20-3
AKOS025291103
filgotinib (glpg0634)
DTXSID80152935
gplg0634
J-690063
mfcd20527867
EX-A741
HMS3653P15
filgotinib; gplg0634
D10871
filgotinib (usan/inn)
NCGC00345855-07
n-[5-[4-[(1,1-dioxido-4-thiomorpholinyl)methyl]phenyl][1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide
SW220020-1
filgotinib(glpg0634)
FT-0700114
FT-0761510
syn1158;glpg 0634; glpg-0634; filgotinib
BCP08496
filgotinib pound glpg0643)
DB14845
AS-16295
Q19904163
SB16799
HMS3673E07
AMY3802
CCG-268951
n-(5-(4-((1,1-dioxidothiomorpholino)methyl)phenyl)-[1,2,4]triazolo[1,5-a]pyridin-2-yl)cyclopropanecarboxamide.
A892158
glpg0634;n-[5-[4-[(1,1-dioxido-4-thiomorpholinyl)methyl]phenyl][1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide
P12798
nsc800100
nsc-800100
BF159062
n-(5-{4-[(1,1-dioxo-1lambda6-thiomorpholin-4-yl)methyl]phenyl}-[1,2,4]triazolo[1,5-a]pyridin-2-yl)cyclopropanecarboxamide
EN300-7419864
Z2037280227

Research Excerpts

Toxicity

ExcerptReferenceRelevance
" 37 (57%) patients who received filgotinib and 39 (59%) patients who received placebo had at least one treatment-emergent adverse event."( Efficacy and safety of filgotinib, a selective Janus kinase 1 inhibitor, in patients with active psoriatic arthritis (EQUATOR): results from a randomised, placebo-controlled, phase 2 trial.
Abi-Saab, W; Besuyen, R; Coates, LC; Dudek, A; Gladman, DD; Greer, JM; Harrison, P; Helliwell, PS; Kunder, R; Mease, P; Meuleners, L; Mozaffarian, N; Rychlewska-Hanczewska, A; Stanislavchuk, M; Tasset, C; Van den Bosch, F; Van der Aa, A, 2018
)
0.48
" Treatment-emergent adverse events were reported in 18 patients in each group, the most common being nasopharyngitis (in two patients in the filgotinib group and in four patients in the placebo group)."( Efficacy and safety of filgotinib, a selective Janus kinase 1 inhibitor, in patients with active ankylosing spondylitis (TORTUGA): results from a randomised, placebo-controlled, phase 2 trial.
Abi-Saab, W; Baraliakos, X; Besuyen, R; Deodhar, A; Gensler, LS; Greer, JM; Hendrikx, T; Landewé, R; Liu, K; Maksymowych, WP; Meuleners, L; Mozaffarian, N; Nadashkevich, O; Tasset, C; Tseluyko, V; van der Heijde, D, 2018
)
0.48
"Filgotinib is efficacious and safe for the treatment of patients with active ankylosing spondylitis who have not responded to first-line pharmacological therapy with NSAIDs."( Efficacy and safety of filgotinib, a selective Janus kinase 1 inhibitor, in patients with active ankylosing spondylitis (TORTUGA): results from a randomised, placebo-controlled, phase 2 trial.
Abi-Saab, W; Baraliakos, X; Besuyen, R; Deodhar, A; Gensler, LS; Greer, JM; Hendrikx, T; Landewé, R; Liu, K; Maksymowych, WP; Meuleners, L; Mozaffarian, N; Nadashkevich, O; Tasset, C; Tseluyko, V; van der Heijde, D, 2018
)
0.48
" No significant differences were observed in the incidence of serious adverse events after treatment with tofacitinib + MTX, filgotinib + MTX, adalimumab + MTX, or placebo + MTX."( Comparison of the efficacy and safety of tofacitinib and filgotinib in patients with active rheumatoid arthritis: a Bayesian network meta-analysis of randomized controlled trials.
Lee, YH; Song, GG, 2020
)
0.56
"In patients with RA exhibiting an inadequate response to cs- or bDMARDs, tofacitinib 10 mg + MTX and filgotinib 200 mg + MTX were the most efficacious interventions and risks of serious adverse events did not differ between tofacitinib and filgotinib groups."( Comparison of the efficacy and safety of tofacitinib and filgotinib in patients with active rheumatoid arthritis: a Bayesian network meta-analysis of randomized controlled trials.
Lee, YH; Song, GG, 2020
)
0.56
" The primary outcome was incidence rates of adverse events (AEs) and serious AEs."( Safety of Janus Kinase Inhibitors in Patients With Inflammatory Bowel Diseases or Other Immune-mediated Diseases: A Systematic Review and Meta-Analysis.
Bonovas, S; Danese, S; Lasa, JS; Olivera, PA; Peyrin-Biroulet, L, 2020
)
0.56
" The safety based on the number of serious adverse events (SAEs) did not differ significantly among 6 six interventions."( Comparative efficacy and safety of 100 mg and 200 mg filgotinib administered to patients with active rheumatoid arthritis: A Bayesian network meta-analysis of randomized controlled trials
.
Lee, YH; Song, GG, 2020
)
0.56
" Tofacitinib 5 mg, filgotinib 200 mg, and placebo showed a significantly lower serious adverse event rate than upadacitinib 15 mg."( Comparative efficacy and safety of tofacitinib, baricitinib, upadacitinib, and filgotinib in active rheumatoid arthritis refractory to biologic disease-modifying antirheumatic drugs.
Lee, YH; Song, GG, 2021
)
0.62
" However, the number of patients who experienced serious adverse events did not differ significantly between the JAK inhibitors, except for tofacitinib 5 mg, and placebo."( Comparative efficacy and safety of tofacitinib, baricitinib, upadacitinib, filgotinib and peficitinib as monotherapy for active rheumatoid arthritis.
Gyu Song, G; Ho Lee, Y, 2020
)
0.56
" The safety analysis based on serious adverse events, adverse events (AEs), and withdrawals due to AEs revealed no statistically significant differences between the respective intervention groups."( Comparative study of the efficacy and safety of tofacitinib, baricitinib, upadacitinib, and filgotinib versus methotrexate for disease-modifying antirheumatic drug-naïve patients with rheumatoid arthritis.
Lee, YH; Sung, YK, 2021
)
0.62
" Safety analyses were performed using the safety analysis set and the exposure-adjusted incidence rate (EAIR) of treatment-emergent adverse events (TEAEs) was calculated."( Safety and Efficacy of Filgotinib: Up to 4-year Results From an Open-label Extension Study of Phase II Rheumatoid Arthritis Programs.
Alten, R; An, D; Besuyen, R; Genovese, MC; Greenwald, M; Kavanaugh, A; Lee, SJ; Meuleners, L; Spindler, AJ; Stanislavchuk, M; Sundy, JS; Tan, Y; Westhovens, RR; Winthrop, KL; Ye, L, 2021
)
0.62
" We calculated exposure-adjusted incidence rates (EAIRs)/100 patient-years filgotinib exposure (100PYE) for treatment-emergent adverse events (TEAEs)."( Integrated safety analysis of filgotinib in patients with moderately to severely active rheumatoid arthritis receiving treatment over a median of 1.6 years.
Bartok, B; Besuyen, R; Burmester, GR; Chen, K; Genovese, MC; Gottenberg, JE; Jahreis, A; Jiang, D; Kivitz, A; Matzkies, F; Takeuchi, T; Tanaka, Y; Winthrop, KL, 2022
)
0.72
"Filgotinib once daily combined with MTX was effective and generally safe and well tolerated up to Week 24 in Japanese patients with RA and inadequate response to MTX."( Efficacy and safety of filgotinib in combination with methotrexate in Japanese patients with active rheumatoid arthritis who have an inadequate response to methotrexate: Subpopulation analyses of 24-week data of a global phase 3 study (FINCH 1).
Amano, K; Atsumi, T; Bae, SC; Bartok, B; Combe, BG; Guo, Y; Ishiguro, N; Keystone, EC; Kivitz, AJ; Kondo, A; Matsubara, T; Matzkies, F; Nash, P; Pechonkina, A; Sugiyama, E; Sundy, JS; Takeuchi, T; Tanaka, Y; Tasset, C; Yamaoka, K; Ye, L, 2022
)
0.72
" Adverse event rates were comparable across treatments and between the Japanese and overall populations."( Efficacy and safety of filgotinib alone and in combination with methotrexate in Japanese patients with active rheumatoid arthritis and limited or no prior exposure to methotrexate: Subpopulation analyses of 24-week data of a global phase 3 study (FINCH 3)
Amano, K; Atsumi, T; Bartok, B; Burmester, GR; Ching, DWT; Guo, Y; Ishiguro, N; Kondo, A; Matsubara, T; Messina, OD; Pechonkina, A; Sugiyama, E; Sundy, JS; Takeuchi, T; Tanaka, Y; Tasset, C; Westhovens, R; Yamaoka, K; Yin, Z, 2022
)
0.72
" We calculated exposure-adjusted incidence rates (EAIRs) per 100 patient-years FIL exposure (100PYE) for treatment-emergent adverse events (TEAEs) and adverse events of special interest."( Integrated safety analysis of filgotinib treatment for rheumatoid arthritis in patients from Japan over a median of 1.5 years.
Amano, K; Atsumi, T; Bartok, B; Besuyen, R; Burmester, GR; Genovese, MC; Gottenberg, JE; Guo, Y; Ishiguro, N; Jiang, D; Kivitz, A; Kondo, A; Matsubara, T; Matzkies, F; Pechonkina, A; Sugiyama, E; Takeuchi, T; Tanaka, Y; Winthrop, K; Yamaoka, K, 2023
)
0.91
" Treatment-emergent adverse events (AEs) represented safety outcomes."( Safety and efficacy of filgotinib, lanraplenib and tirabrutinib in Sjögren's syndrome: a randomized, phase 2, double-blind, placebo-controlled study.
Bombardieri, M; Downie, B; Gottenberg, JE; Gurtovaya, O; Jiang, W; Kivitz, A; Mathur, A; Matzkies, F; Mozaffarian, A; Mozaffarian, N; Pechonkina, A; Price, E, 2022
)
0.72
" The primary endpoint was W12 American College of Rheumatology 20% improvement; safety was assessed by adverse event (AE) reporting."( Safety and efficacy of filgotinib for Japanese patients with RA and inadequate response to MTX: FINCH 1 52-week results and FINCH 4 48-week results.
Amano, K; Atsumi, T; Bae, SC; Bartok, B; Combe, BG; Genovese, M; Gong, Q; Ishiguro, N; Keystone, EC; Kivitz, AJ; Kondo, A; Matsubara, T; Matzkies, F; Nash, P; Pechonkina, A; Sugiyama, E; Takeuchi, T; Tanaka, Y; Tasset, C; Yamaoka, K; Ye, L, 2023
)
0.91
"In the 56 Japanese patients treated with FIL, efficacy was maintained through Week 52 and beyond, with no increases in the incidence of adverse events."( Long-term safety and efficacy of filgotinib treatment for rheumatoid arthritis in Japanese patients naïve to MTX treatment (FINCH 3).
Amano, K; Atsumi, T; Bartok, B; Burmester, GR; Ching, DWT; Genovese, M; Gong, Q; Ishiguro, N; Kondo, A; Matsubara, T; Messina, OD; Pechonkina, A; Sugiyama, E; Takeuchi, T; Tanaka, Y; Tasset, C; Westhovens, R; Yamaoka, K; Yin, Z, 2023
)
0.91
" The safety outcomes included treatment-emergent adverse events (TEAEs) and serious TEAEs."( Efficacy and safety of filgotinib in patients with rheumatoid arthritis and inadequate response to disease-modifying antirheumatic drugs (DMARDs): A meta-analysis of randomized controlled trials.
Chu, T; Liu, B; Liu, Z; Lu, L; Ma, D; Pan, L; Ren, J; Wang, Y; Yu, L, 2022
)
0.72
" Exposure-adjusted incidence rates (EAIRs) per 100 censored patient-years of exposure with 95% confidence intervals were reported for treatment-emergent adverse events (AEs)."( Integrated safety analysis of filgotinib for ulcerative colitis: Results from SELECTION and SELECTIONLTE.
Danese, S; de Haas, A; Faes, M; Hsieh, J; Loftus, EV; Maaser, C; Moerch, U; Oortwijn, A; Rogler, G; Rudolph, C; Schreiber, S; Van Hoek, P; Vermeire, S; Watanabe, M; Zhou, Y, 2023
)
0.91
" EAIRs for serious infection, thromboembolic events and major adverse cardiovascular events (MACE) were consistently low across treatment groups."( Integrated safety analysis of filgotinib for ulcerative colitis: Results from SELECTION and SELECTIONLTE.
Danese, S; de Haas, A; Faes, M; Hsieh, J; Loftus, EV; Maaser, C; Moerch, U; Oortwijn, A; Rogler, G; Rudolph, C; Schreiber, S; Van Hoek, P; Vermeire, S; Watanabe, M; Zhou, Y, 2023
)
0.91

Pharmacokinetics

ExcerptReferenceRelevance
" Non-compartmental analysis was used to determine individual pharmacokinetic parameters for filgotinib and its metabolite."( Pharmacokinetics and Pharmacokinetic/Pharmacodynamic Modeling of Filgotinib (GLPG0634), a Selective JAK1 Inhibitor, in Support of Phase IIB Dose Selection.
Cox, E; Diderichsen, PM; Namour, F; Tasset, C; Van der Aa, A; Van't Klooster, G; Vayssière, B, 2015
)
0.65
"Modeling and simulation on the basis of early clinical data suggest that the pharmacokinetics of filgotinib are dose proportional up to 200 mg, in agreement with observed data, and support that both filgotinib and its metabolite contribute to its pharmacodynamic effects."( Pharmacokinetics and Pharmacokinetic/Pharmacodynamic Modeling of Filgotinib (GLPG0634), a Selective JAK1 Inhibitor, in Support of Phase IIB Dose Selection.
Cox, E; Diderichsen, PM; Namour, F; Tasset, C; Van der Aa, A; Van't Klooster, G; Vayssière, B, 2015
)
0.65
" Ex vivo pharmacodynamic data from phase 1 healthy volunteers clinically confirmed JAK1 selectivity of filgotinib."( JAK selectivity and the implications for clinical inhibition of pharmacodynamic cytokine signalling by filgotinib, upadacitinib, tofacitinib and baricitinib.
Campigotto, F; Di Paolo, JA; Galien, R; Meng, A; Murray, B; Traves, PG, 2021
)
0.62
" Serial pharmacokinetic blood samples were collected, and safety was assessed."( Assessment of the Effect of Filgotinib on the Pharmacokinetics of Atorvastatin, Pravastatin, and Rosuvastatin in Healthy Adult Participants.
Alani, M; Anderson, K; Gong, Q; Nelson, CH; Othman, AA; Tarnowski, T, 2022
)
0.72

Compound-Compound Interactions

ExcerptReferenceRelevance
" As RA patients might be treated with multiple medications simultaneously, possible drug-drug interactions of filgotinib with cytochrome P450 enzymes and with key drug transporters were evaluated in vitro and in clinical studies."( Clinical Confirmation that the Selective JAK1 Inhibitor Filgotinib (GLPG0634) has a Low Liability for Drug-drug Interactions.
Desrivot, J; Harrison, P; Namour, F; Tasset, C; Van der Aa, A; van't Klooster, G, 2016
)
0.67
"In vitro, filgotinib and its active metabolite at clinically relevant concentrations did not interact with cytochrome P450 enzymes and uridine 5'-diphospho-glucuronosyltransferases, and did not inhibit key drug transporters."( Clinical Confirmation that the Selective JAK1 Inhibitor Filgotinib (GLPG0634) has a Low Liability for Drug-drug Interactions.
Desrivot, J; Harrison, P; Namour, F; Tasset, C; Van der Aa, A; van't Klooster, G, 2016
)
0.67
" A drug-drug interaction study to evaluate the potential effect of FIL on the pharmacokinetics (PK) of the oral contraceptive levonorgestrel (LEVO)/ethinyl estradiol (EE) was conducted."( Lack of Drug-Drug Interaction Between Filgotinib, a Selective JAK1 Inhibitor, and Oral Hormonal Contraceptives Levonorgestrel/Ethinyl Estradiol in Healthy Volunteers.
Ampaw, L; Anderson, K; Begley, R; Kearney, BP; Mathias, A; Qin, A; Watkins, TR; Weng, W, 2021
)
0.62
"Filgotinib once daily combined with MTX was effective and generally safe and well tolerated up to Week 24 in Japanese patients with RA and inadequate response to MTX."( Efficacy and safety of filgotinib in combination with methotrexate in Japanese patients with active rheumatoid arthritis who have an inadequate response to methotrexate: Subpopulation analyses of 24-week data of a global phase 3 study (FINCH 1).
Amano, K; Atsumi, T; Bae, SC; Bartok, B; Combe, BG; Guo, Y; Ishiguro, N; Keystone, EC; Kivitz, AJ; Kondo, A; Matsubara, T; Matzkies, F; Nash, P; Pechonkina, A; Sugiyama, E; Sundy, JS; Takeuchi, T; Tanaka, Y; Tasset, C; Yamaoka, K; Ye, L, 2022
)
0.72

Bioavailability

ExcerptReferenceRelevance
" This phase 1 study in healthy subjects evaluated the relative bioavailability of filgotinib maleate tablets versus the reference tablet (filgotinib hydrochloride) and effects of food and acid-reducing agents (ARAs) on the pharmacokinetics of filgotinib and its major metabolite."( The Relative Bioavailability and Effects of Food and Acid-Reducing Agents on Filgotinib Tablets in Healthy Subjects.
Anderson, K; Cuvin, J; Kotecha, M; Namour, F; Qin, AR; Scott, B; Sharma, S; Xin, Y; Zheng, H, 2019
)
0.51
"The ATP-binding cassette transporter P-glycoprotein (P-gp) is known to limit both brain penetration and oral bioavailability of many chemotherapy drugs."( A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein.
Ambudkar, SV; Brimacombe, KR; Chen, L; Gottesman, MM; Guha, R; Hall, MD; Klumpp-Thomas, C; Lee, OW; Lee, TD; Lusvarghi, S; Robey, RW; Shen, M; Tebase, BG, 2019
)
0.51

Dosage Studied

ExcerptRelevanceReference
" Oral dosing of GLPG0634 in a therapeutic set-up in a collagen-induced arthritis model in rodents resulted in a significant dose-dependent reduction of the disease progression."( Preclinical characterization of GLPG0634, a selective inhibitor of JAK1, for the treatment of inflammatory diseases.
Brys, R; Christophe, T; Clement-Lacroix, P; Conrath, K; De Vos, S; Feyen, JH; Fletcher, S; Galien, R; Lepescheux, L; Menet, C; Nelles, L; Smets, B; van 't Klooster, G; van der Aar, EM; Van Rompaey, L; Vandeghinste, N; Vayssiere, B, 2013
)
1.02
" Accordingly, blood collection via DBS was performed in male BALB/c mice following intravenous and oral dosing of darolutamide; in male Sprague Dawley rats following intravenous and oral dosing of filgotinib."( Novel methodology to perform incurred sample reanalysis on dried blood spot cards: Experimental data using darolutamide and filgotinib.
Dixit, A; Gabani, BB; Kiran, V; Mullangi, R; Srinivas, NR, 2020
)
0.56
" Greater proportions of patients experienced clinically meaningful differences with either dosage of FIL in combination with csDMARDs (including MTX) and with FIL200 monotherapy vs comparators."( The impact of filgotinib on patient-reported outcomes and health-related quality of life for patients with active rheumatoid arthritis: a post hoc analysis of Phase 3 studies.
Bingham, CO; Combe, B; Hu, H; Khalid, JM; Lee, SJ; Nash, P; Walker, D; Ye, L, 2022
)
0.72
[information is derived through text-mining from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Protein Targets (306)

Potency Measurements

ProteinTaxonomyMeasurementAverage (µ)Min (ref.)Avg (ref.)Max (ref.)Bioassay(s)
PPM1D proteinHomo sapiens (human)Potency16.53880.00529.466132.9993AID1347411
EWS/FLI fusion proteinHomo sapiens (human)Potency10.91450.001310.157742.8575AID1259252; AID1259253; AID1259255; AID1259256
Interferon betaHomo sapiens (human)Potency16.53880.00339.158239.8107AID1347411
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Inhibition Measurements

ProteinTaxonomyMeasurementAverageMin (ref.)Avg (ref.)Max (ref.)Bioassay(s)
Tyrosine-protein kinase JAK2Homo sapiens (human)GI5010.00000.02402.81259.0230AID1708123
Tyrosine-protein kinase JAK2Homo sapiens (human)IC50 (µMol)3.61220.00010.372210.0000AID1157423; AID1157424; AID1157425; AID1170503; AID1170504; AID1170505; AID1170506; AID1170507; AID1170508; AID1251059; AID1412232; AID1663655; AID1663660; AID1708116; AID1709136; AID1875944; AID1898243; AID1898281; AID1898282; AID1912665; AID1913077
Cytochrome P450 1A2Homo sapiens (human)IC50 (µMol)67.80000.00011.774010.0000AID1170524; AID1898260
Cytochrome P450 2E1Homo sapiens (human)IC50 (µMol)85.00000.01401.68726.2000AID1412252
Macrophage colony-stimulating factor 1 receptorHomo sapiens (human)IC50 (µMol)0.48890.00060.56765.5450AID1170531; AID1913537
Cytochrome P450 3A4Homo sapiens (human)IC50 (µMol)85.00000.00011.753610.0000AID1170527; AID1898266
Cytochrome P450 2C8Homo sapiens (human)IC50 (µMol)100.00000.00081.88487.9000AID1898262
Cytochrome P450 2D6Homo sapiens (human)IC50 (µMol)85.00000.00002.015110.0000AID1170526; AID1898265
Cytochrome P450 2C9 Homo sapiens (human)IC50 (µMol)85.00000.00002.800510.0000AID1170525; AID1898263
Cytochrome P450 2B6Homo sapiens (human)IC50 (µMol)100.00000.00113.418610.0000AID1898261
Tyrosine-protein kinase JAK1Homo sapiens (human)GI500.79800.09533.27348.9270AID1708122
Tyrosine-protein kinase JAK1Homo sapiens (human)IC50 (µMol)1.20240.00030.23787.3000AID1157422; AID1157423; AID1157424; AID1170454; AID1170500; AID1170501; AID1170502; AID1170503; AID1170504; AID1170506; AID1251058; AID1412231; AID1663654; AID1663659; AID1708115; AID1709135; AID1875947; AID1898242; AID1898281; AID1898283; AID1898284; AID1912664; AID1913076
Non-receptor tyrosine-protein kinase TYK2Homo sapiens (human)GI507.19101.52404.35757.1910AID1708125
Non-receptor tyrosine-protein kinase TYK2Homo sapiens (human)IC50 (µMol)2.13280.00020.29504.1000AID1157423; AID1157424; AID1157425; AID1170502; AID1251061; AID1412235; AID1708118; AID1709138; AID1898245; AID1898281; AID1898284; AID1913535; AID1913536
Cytochrome P450 2C19Homo sapiens (human)IC50 (µMol)79.10000.00002.398310.0000AID1170528; AID1898264
Vascular endothelial growth factor receptor 3Homo sapiens (human)IC50 (µMol)0.27400.00010.22644.9000AID1170530; AID1913539
Receptor-type tyrosine-protein kinase FLT3Homo sapiens (human)IC50 (µMol)0.33800.00010.32759.5480AID1170529; AID1913538
Tyrosine-protein kinase JAK3Homo sapiens (human)GI5010.00000.35000.42650.5030AID1708124
Tyrosine-protein kinase JAK3Homo sapiens (human)IC50 (µMol)3.58670.00010.41937.9200AID1157423; AID1157424; AID1170500; AID1170501; AID1251060; AID1412234; AID1663656; AID1663661; AID1708117; AID1709137; AID1898244; AID1898283
Potassium voltage-gated channel subfamily H member 2Homo sapiens (human)IC50 (µMol)90.00000.00091.901410.0000AID1170523; AID1389260; AID1412252
Jak1 proteinRattus norvegicus (Norway rat)IC50 (µMol)0.02900.02900.02900.0290AID1170535
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Activation Measurements

ProteinTaxonomyMeasurementAverageMin (ref.)Avg (ref.)Max (ref.)Bioassay(s)
Bone morphogenetic protein receptor type-1BHomo sapiens (human)Kd30.00000.00091.14133.7000AID1424922
Membrane-associated progesterone receptor component 1Homo sapiens (human)Kd30.00000.20400.20400.2040AID1425109
Serine/threonine-protein kinase PLK4Homo sapiens (human)Kd30.00000.00081.51449.0000AID1425121
ATP-dependent RNA helicase DDX3XHomo sapiens (human)Kd30.00000.43500.43500.4350AID1424975
Pyridoxal kinaseHomo sapiens (human)Kd30.00000.28605.076516.4040AID1425106
Citron Rho-interacting kinaseHomo sapiens (human)Kd30.00000.03303.064648.8760AID1424954
Serine/threonine-protein kinase Chk1Homo sapiens (human)Kd30.00000.00281.47448.7000AID1424953
Aurora kinase AHomo sapiens (human)Kd30.00000.00010.73429.3000AID1424917
Cyclin-G-associated kinaseHomo sapiens (human)Kd30.00000.00030.908628.6510AID1425009
Ephrin type-B receptor 6Homo sapiens (human)Kd30.00000.00001.07689.0000AID1424995
Peroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)Kd30.00000.02601.31402.6020AID1424896
Receptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)Kd30.00000.00201.621211.4330AID1425155
Mitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)Kd30.00000.09401.39103.5070AID1424926
Dynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)Kd30.00000.01700.36100.7050AID1425097
Tyrosine-protein kinase JAK2Homo sapiens (human)Kd0.03200.00000.88517.0000AID1913533
Eukaryotic translation initiation factor 5BHomo sapiens (human)Kd30.00000.23200.23200.2320AID1424986
Rho-associated protein kinase 2Homo sapiens (human)Kd30.00000.00022.710556.0660AID1425158
Serine/threonine-protein kinase ULK1Homo sapiens (human)Kd30.00000.00081.841023.2730AID1425208
Serine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)Kd30.00000.00572.009512.2010AID1424997
Ribosomal protein S6 kinase alpha-5Homo sapiens (human)Kd30.00000.01701.973729.9570AID1425162
U5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)Kd30.00001.38201.38201.3820AID1425174
Ribosomal protein S6 kinase alpha-4Homo sapiens (human)Kd30.00000.01201.63967.2000AID1425161
Serine/threonine-protein kinase 16Homo sapiens (human)Kd30.00000.00171.24839.9690AID1425179
Serine/threonine-protein kinase 10Homo sapiens (human)Kd1.91200.00002.923457.4530AID1425177
Serine/threonine-protein kinase D3Homo sapiens (human)Kd30.00000.00892.273823.3410AID1425137
Structural maintenance of chromosomes protein 2Homo sapiens (human)Kd30.00000.20900.65751.1060AID1425173
Mitogen-activated protein kinase kinase kinase 6Homo sapiens (human)Kd30.00000.17001.57818.0000AID1425050
Mitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)Kd30.00000.00822.364562.7720AID1425054
Serine/threonine-protein kinase LATS1Homo sapiens (human)Kd30.00000.01401.839310.7330AID1425033
Serine/threonine-protein kinase PAK 4Homo sapiens (human)Kd30.00000.00272.569430.3710AID1425100
Tyrosine-protein kinase ABL1Homo sapiens (human)Kd30.00000.00001.041113.4530AID1424890
Epidermal growth factor receptorHomo sapiens (human)Kd30.00000.00011.351420.8270AID1424983
High affinity nerve growth factor receptorHomo sapiens (human)Kd30.00000.00201.34849.2000AID1425094
ADP/ATP translocase 2Homo sapiens (human)Kd30.00000.45100.45100.4510AID1425169
Protein kinase C beta typeHomo sapiens (human)Kd30.00000.00132.708126.3240AID1425130
Insulin receptorHomo sapiens (human)Kd30.00000.00171.08237.9060AID1425026
Tyrosine-protein kinase LckHomo sapiens (human)Kd30.00000.00021.117424.2210AID1425034
Tyrosine-protein kinase FynHomo sapiens (human)Kd30.00000.00081.42388.4000AID1425008
Cyclin-dependent kinase 1Homo sapiens (human)Kd30.00000.28801.49523.0490AID1424937
Glycogen phosphorylase, liver formHomo sapiens (human)Kd30.00002.12102.12102.1210AID1425146
Tyrosine-protein kinase Fes/FpsHomo sapiens (human)Kd30.00000.00481.09867.4000AID1425003
Adenine phosphoribosyltransferaseHomo sapiens (human)Kd30.00000.02900.02900.0290AID1424914
Tyrosine-protein kinase YesHomo sapiens (human)Kd30.00000.00031.370817.1520AID1425212
Tyrosine-protein kinase LynHomo sapiens (human)Kd30.00000.00061.04855.7000AID1425037
Proto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)Kd30.00000.00070.864227.5420AID1425154
Insulin-like growth factor 1 receptorHomo sapiens (human)Kd30.00000.00101.921119.2170AID1425022
Signal recognition particle receptor subunit alphaHomo sapiens (human)Kd30.00000.00800.00800.0080AID1425176
Cytochrome c1, heme protein, mitochondrialHomo sapiens (human)Kd30.00000.20200.20200.2020AID1424969
Hepatocyte growth factor receptorHomo sapiens (human)Kd30.00000.00021.62978.5000AID1425076
Tyrosine-protein kinase HCKHomo sapiens (human)Kd30.00000.00032.034315.9930AID1425017
Platelet-derived growth factor receptor betaHomo sapiens (human)Kd30.00000.00011.005011.1070AID1425104
Serine/threonine-protein kinase A-RafHomo sapiens (human)Kd30.00000.04709.683233.6550AID1424915
Glycogen phosphorylase, brain formHomo sapiens (human)Kd30.00003.56903.56903.5690AID1425145
Breakpoint cluster region proteinHomo sapiens (human)Kd30.00000.00301.219617.3640AID1424919
Serine/threonine-protein kinase pim-1Homo sapiens (human)Kd30.00000.00101.139319.3160AID1425111
Fibroblast growth factor receptor 1Homo sapiens (human)Kd30.00000.00031.55816.2000AID1425004
Cyclin-dependent kinase 4Homo sapiens (human)Kd30.00000.00331.60508.6000AID1424946
ADP/ATP translocase 3Homo sapiens (human)Kd30.00000.00600.25050.4950AID1425170
Proto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)Kd30.00000.00021.50779.6000AID1425175
cAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)Kd30.00000.05201.75353.4550AID1425128
Serine/threonine-protein kinase B-rafHomo sapiens (human)Kd30.00000.00021.625826.0180AID1424924
Phosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)Kd30.00000.00012.05699.5000AID1425110
Ribosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)Kd30.00000.00406.755688.9030AID1425093
Tyrosine-protein kinase FerHomo sapiens (human)Kd30.00000.00141.36048.8000AID1425002
Protein kinase C alpha typeHomo sapiens (human)Kd30.00000.00031.792221.3520AID1425129
cAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)Kd30.00000.00392.947923.2450AID1425123
General transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)Kd30.00000.00201.690612.0220AID1424996
Casein kinase II subunit alpha'Homo sapiens (human)Kd30.00000.00102.530928.8720AID1424968
Ras-related protein Rab-6AHomo sapiens (human)Kd30.00000.03300.03300.0330AID1425150
Ephrin type-A receptor 1Homo sapiens (human)Kd30.00000.00411.80009.8000AID1424987
Multifunctional protein ADE2Homo sapiens (human)Kd30.00005.48105.48105.4810AID1425098
cAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)Kd30.00000.00208.557749.2780AID1425125
cAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)Kd30.00000.01300.74084.1000AID1425124
Ferrochelatase, mitochondrialHomo sapiens (human)Kd30.00000.24306.434367.9140AID1425001
Ribosomal protein S6 kinase beta-1Homo sapiens (human)Kd30.00000.00131.18054.8000AID1425164
Tyrosine-protein kinase JAK1Homo sapiens (human)Kd15.00550.00161.21667.8000AID1425030; AID1913532
Cyclin-dependent kinase 2Homo sapiens (human)Kd30.00000.00701.517910.4870AID1424944
Beta-adrenergic receptor kinase 1Homo sapiens (human)Kd30.00000.17005.579122.4940AID1424908
Probable ATP-dependent RNA helicase DDX6Homo sapiens (human)Kd30.00004.10304.10304.1030AID1424977
Mitogen-activated protein kinase 3 Homo sapiens (human)Kd30.00000.43005.27439.8000AID1425061
MAP/microtubule affinity-regulating kinase 3Homo sapiens (human)Kd30.00000.00303.968958.2400AID1425069
Deoxycytidine kinaseHomo sapiens (human)Kd30.00000.01201.08752.1630AID1424970
Mitogen-activated protein kinase 1Homo sapiens (human)Kd30.00000.00012.74417.3000AID1425056
Ephrin type-A receptor 2Homo sapiens (human)Kd30.00000.00091.07528.1980AID1424988
Ephrin type-B receptor 2Homo sapiens (human)Kd30.00000.00043.153653.1980AID1424992
Non-receptor tyrosine-protein kinase TYK2Homo sapiens (human)Kd30.00000.00091.55758.7000AID1425207
UMP-CMP kinase Homo sapiens (human)Kd30.00000.00300.00450.0060AID1424959
Phosphatidylethanolamine-binding protein 1Homo sapiens (human)Kd30.00000.00300.00300.0030AID1425107
Wee1-like protein kinaseHomo sapiens (human)Kd30.00000.00143.538965.1580AID1425210
Heme oxygenase 2Homo sapiens (human)Kd30.00000.11900.11900.1190AID1425018
DnaJ homolog subfamily A member 1Homo sapiens (human)Kd30.00000.96200.96200.9620AID1424980
RAC-alpha serine/threonine-protein kinaseHomo sapiens (human)Kd30.00000.00061.06214.4000AID1424910
RAC-beta serine/threonine-protein kinaseHomo sapiens (human)Kd30.00000.00211.61968.7000AID1424911
DNA replication licensing factor MCM4Homo sapiens (human)Kd30.00000.62900.62900.6290AID1425072
Myosin-10Homo sapiens (human)Kd30.00000.22900.49350.7580AID1425079
Dual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)Kd30.00000.00391.64299.6000AID1425039
Receptor-type tyrosine-protein kinase FLT3Homo sapiens (human)Kd30.00000.00020.95599.9000AID1425006
Bone morphogenetic protein receptor type-1AHomo sapiens (human)Kd30.00000.06001.50107.0000AID1424921
Activin receptor type-1BHomo sapiens (human)Kd30.00000.00401.511015.2580AID1424901
TGF-beta receptor type-1Homo sapiens (human)Kd30.00000.00502.27859.6000AID1425196
TGF-beta receptor type-2Homo sapiens (human)Kd30.00000.08001.83516.9000AID1425197
Electron transfer flavoprotein subunit betaHomo sapiens (human)Kd30.00000.01200.01200.0120AID1424999
Tyrosine-protein kinase CSKHomo sapiens (human)Kd30.00000.00103.457839.5530AID1424960
Glycine--tRNA ligaseHomo sapiens (human)Kd30.00000.04000.04000.0400AID1425010
Protein kinase C iota typeHomo sapiens (human)Kd30.00000.02609.331651.0180AID1425133
Exosome RNA helicase MTR4Homo sapiens (human)Kd30.00002.60702.60702.6070AID1425168
Tyrosine-protein kinase TecHomo sapiens (human)Kd30.00000.00101.00958.7000AID1425193
Tyrosine-protein kinase ABL2Homo sapiens (human)Kd30.00000.00021.124914.9240AID1424891
Tyrosine-protein kinase FRKHomo sapiens (human)Kd30.00000.00031.242410.8370AID1425007
Tyrosine-protein kinase SYKHomo sapiens (human)Kd30.00000.00702.00529.2260AID1425188
26S proteasome regulatory subunit 6BHomo sapiens (human)Kd30.00000.00500.00500.0050AID1425141
Mitogen-activated protein kinase 8Homo sapiens (human)Kd30.00000.01102.096526.0590AID1425063
Mitogen-activated protein kinase 9Homo sapiens (human)Kd30.00000.00201.45968.1000AID1425064
Dual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)Kd30.00000.00381.62649.9000AID1425041
Dual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)Kd30.00000.00502.04626.6000AID1425040
Phosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)Kd30.00000.20803.61257.0170AID1425113
Casein kinase I isoform alphaHomo sapiens (human)Kd30.00000.00102.575619.3520AID1424961
Casein kinase I isoform deltaHomo sapiens (human)Kd30.00000.01502.227018.3960AID1424962
MAP kinase-activated protein kinase 2Homo sapiens (human)Kd30.00000.00032.027414.7420AID1425065
Elongation factor Tu, mitochondrialHomo sapiens (human)Kd30.00000.46400.46400.4640AID1425206
Choline-phosphate cytidylyltransferase AHomo sapiens (human)Kd30.00000.04100.04100.0410AID1425103
Casein kinase I isoform epsilonHomo sapiens (human)Kd30.00000.01301.408612.4090AID1424963
Very long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)Kd30.00001.68901.68901.6890AID1424894
Dual specificity protein kinase CLK2Homo sapiens (human)Kd30.00000.00701.13846.5000AID1424956
Glycogen synthase kinase-3 alphaHomo sapiens (human)Kd30.00000.00602.475422.5430AID1425013
Glycogen synthase kinase-3 betaHomo sapiens (human)Kd30.00000.00701.00576.1680AID1425014
Cyclin-dependent kinase 7Homo sapiens (human)Kd30.00000.00251.67837.7000AID1424949
Cyclin-dependent kinase 9Homo sapiens (human)Kd30.00000.00101.61669.9010AID1424950
Ras-related protein Rab-27AHomo sapiens (human)Kd30.00004.49304.49304.4930AID1425149
Interleukin-1 receptor-associated kinase 1Homo sapiens (human)Kd4.71400.00611.52528.5000AID1425027
Ribosomal protein S6 kinase alpha-3Homo sapiens (human)Kd30.00000.01702.889637.6050AID1425160
Serine/threonine-protein kinase Nek2Homo sapiens (human)Kd30.00000.11001.56496.5000AID1425086
Serine/threonine-protein kinase Nek3Homo sapiens (human)Kd30.00000.17005.936838.0880AID1425087
Tyrosine-protein kinase JAK3Homo sapiens (human)Kd0.30000.00021.06888.7000AID1913534
Dual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)Kd30.00000.00342.39436.5000AID1425043
Serine/threonine-protein kinase PLK1Homo sapiens (human)Kd30.00000.00010.57115.0000AID1425120
LIM domain kinase 1Homo sapiens (human)Kd30.00000.02601.784021.0890AID1425035
LIM domain kinase 2Homo sapiens (human)Kd30.00000.05704.971752.0560AID1425036
Mitogen-activated protein kinase 10Homo sapiens (human)Kd2.14000.00101.63545.9000AID1425057
Tyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)Kd30.00003.31603.31603.3160AID1425211
5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)Kd30.00000.00601.468110.2120AID1425126
Ephrin type-B receptor 3Homo sapiens (human)Kd30.00000.00692.17136.4100AID1424993
Ephrin type-A receptor 5Homo sapiens (human)Kd30.00000.00021.21005.9000AID1424990
Ephrin type-B receptor 4Homo sapiens (human)Kd30.00000.00032.167826.3990AID1424994
Ephrin type-A receptor 4Homo sapiens (human)Kd30.00000.00123.152543.9420AID1424989
Adenylate kinase 2, mitochondrialHomo sapiens (human)Kd30.00001.03601.03601.0360AID1424909
Adenosine kinaseHomo sapiens (human)Kd30.00000.01301.83683.4930AID1424907
Ras-related protein Rab-10Homo sapiens (human)Kd30.00001.34801.34801.3480AID1425148
Actin-related protein 3Homo sapiens (human)Kd30.00000.03602.77355.5110AID1424899
Actin-related protein 2Homo sapiens (human)Kd30.00000.00400.00400.0040AID1424898
GTP-binding nuclear protein RanHomo sapiens (human)Kd30.00000.75900.75900.7590AID1425153
Casein kinase I isoform gamma-2Homo sapiens (human)Kd30.00000.04601.45066.6000AID1424965
Cyclin-dependent kinase 3Homo sapiens (human)Kd30.00000.00803.060263.6140AID1424945
Cyclin-dependent kinase 6Homo sapiens (human)Kd30.00000.03201.20073.3560AID1424948
Cyclin-dependent-like kinase 5 Homo sapiens (human)Kd30.00000.04301.37578.3000AID1424947
Cyclin-dependent kinase 16Homo sapiens (human)Kd30.00000.00111.585510.0000AID1424941
Cyclin-dependent kinase 17Homo sapiens (human)Kd30.00000.00100.82335.6000AID1424942
ATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)Kd30.00000.98300.98300.9830AID1425108
Dual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)Kd30.00000.00021.13868.7730AID1425038
DNA topoisomerase 2-betaHomo sapiens (human)Kd30.00000.14801.22702.5970AID1425203
Protein kinase C theta typeHomo sapiens (human)Kd30.00000.00071.61407.2000AID1425134
Activin receptor type-1Homo sapiens (human)Kd30.00000.00401.485316.1210AID1424900
Macrophage-stimulating protein receptorHomo sapiens (human)Kd30.00000.00302.07188.4000AID1425078
Focal adhesion kinase 1Homo sapiens (human)Kd30.00000.00051.225513.0390AID1425142
Protein kinase C delta typeHomo sapiens (human)Kd30.00000.00021.12619.2060AID1425131
Tyrosine-protein kinase BTKHomo sapiens (human)Kd30.00000.00061.529910.1530AID1424925
Activated CDC42 kinase 1Homo sapiens (human)Kd30.00000.00201.71389.6000AID1425201
Epithelial discoidin domain-containing receptor 1Homo sapiens (human)Kd30.00000.00021.631471.4840AID1424972
Mitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)Kd30.00000.00311.468114.0430AID1425052
Serine/threonine-protein kinase 4Homo sapiens (human)Kd30.00000.00021.712025.9020AID1425185
5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)Kd30.00000.00371.891315.3890AID1425122
Dual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)Kd30.00000.00022.659065.6770AID1425042
Mitogen-activated protein kinase 7Homo sapiens (human)Kd30.00000.04202.00739.9000AID1425062
Serine/threonine-protein kinase PAK 2Homo sapiens (human)Kd30.00000.00312.30456.0000AID1425099
Serine/threonine-protein kinase 3Homo sapiens (human)Kd30.00000.00021.860217.5260AID1425182
Mitogen-activated protein kinase kinase kinase 1Homo sapiens (human)Kd30.00000.09702.599512.4730AID1425044
Integrin-linked protein kinaseHomo sapiens (human)Kd30.00000.02000.46031.3290AID1425024
Rho-associated protein kinase 1Homo sapiens (human)Kd30.00000.00031.755513.4620AID1425157
Non-receptor tyrosine-protein kinase TNK1Homo sapiens (human)Kd30.00000.00181.006411.2690AID1425200
Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)Kd30.00000.00051.02097.8000AID1424929
Calcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)Kd30.00000.00031.504420.3010AID1424928
Dual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)Kd30.00000.00012.101640.2910AID1424981
Activin receptor type-2BHomo sapiens (human)Kd30.00000.00762.73289.9000AID1424902
Bone morphogenetic protein receptor type-2Homo sapiens (human)Kd30.00000.01902.591714.3770AID1424923
Protein-tyrosine kinase 6Homo sapiens (human)Kd30.00000.00431.74309.0000AID1425144
cGMP-dependent protein kinase 1 Homo sapiens (human)Kd30.00000.00160.70723.8000AID1425138
Cyclin-dependent kinase 13Homo sapiens (human)Kd30.00000.00091.25714.5180AID1424940
Inhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)Kd30.00000.00511.10938.3000AID1425023
Protein-tyrosine kinase 2-betaHomo sapiens (human)Kd30.00000.00111.945030.4140AID1425143
Maternal embryonic leucine zipper kinaseHomo sapiens (human)Kd30.00000.00492.283529.9330AID1425074
Structural maintenance of chromosomes protein 1AHomo sapiens (human)Kd30.00000.36500.36500.3650AID1425172
Chromodomain-helicase-DNA-binding protein 4Homo sapiens (human)Kd30.00000.00300.00300.0030AID1424952
Peroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)Kd30.00000.01400.14250.2710AID1424895
Ephrin type-A receptor 7Homo sapiens (human)Kd30.00000.00251.44456.5000AID1424991
Delta(24)-sterol reductaseHomo sapiens (human)Kd30.00000.43200.43200.4320AID1424978
Ribosomal protein S6 kinase alpha-1Homo sapiens (human)Kd30.00000.02802.528622.7260AID1425159
Dual specificity testis-specific protein kinase 1Homo sapiens (human)Kd30.00000.03301.75685.6000AID1425194
Myosin light chain kinase, smooth muscleHomo sapiens (human)Kd30.00000.00301.20887.9000AID1425081
Mitogen-activated protein kinase 11Homo sapiens (human)Kd30.00000.00010.46103.7430AID1425058
Serine/threonine-protein kinase STK11Homo sapiens (human)Kd30.00000.00300.99495.9000AID1425178
Serine/threonine-protein kinase N1Homo sapiens (human)Kd30.00000.00133.172949.8130AID1425117
Serine/threonine-protein kinase N2Homo sapiens (human)Kd30.00000.00181.75279.9000AID1425118
Mitogen-activated protein kinase 14Homo sapiens (human)Kd30.00000.00000.50368.5000AID1425059
Calcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)Kd30.00000.03001.92155.4600AID1424930
Mitogen-activated protein kinase kinase kinase 11Homo sapiens (human)Kd30.00000.01101.563917.9840AID1425045
Discoidin domain-containing receptor 2Homo sapiens (human)Kd30.00000.00301.988842.2800AID1424973
AP2-associated protein kinase 1Homo sapiens (human)Kd4.99000.00121.370713.7110AID1424889
Myosin light chain kinase 3Homo sapiens (human)Kd30.00000.00201.618410.4240AID1425082
Uncharacterized aarF domain-containing protein kinase 5Homo sapiens (human)Kd30.00000.20200.49900.7960AID1424906
Putative heat shock protein HSP 90-beta 2Homo sapiens (human)Kd30.00002.56602.56602.5660AID1425019
Rab-like protein 3Homo sapiens (human)Kd30.00004.83004.83004.8300AID1425151
Serine/threonine-protein kinase MRCK alphaHomo sapiens (human)Kd30.00000.05704.554714.0200AID1424933
Serine/threonine-protein kinase MRCK gammaHomo sapiens (human)Kd30.00000.03701.96259.5000AID1424935
Acyl-CoA dehydrogenase family member 10Homo sapiens (human)Kd30.00000.07801.69973.9570AID1424892
Serine/threonine-protein kinase ULK3Homo sapiens (human)Kd30.00000.00121.33509.9000AID1425209
Uncharacterized protein FLJ45252Homo sapiens (human)Kd4.38400.00301.22929.3110AID1425147
Acyl-CoA dehydrogenase family member 11Homo sapiens (human)Kd30.00001.91603.07304.1470AID1424893
Serine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)Kd30.00000.11600.76041.5000AID1424998
Serine/threonine-protein kinase MARK2Homo sapiens (human)Kd30.00000.00011.842511.1030AID1425068
ATP-dependent RNA helicase DHX30Homo sapiens (human)Kd30.00000.00600.00600.0060AID1424979
Serine/threonine-protein kinase TAO1Homo sapiens (human)Kd30.00000.00042.161218.7570AID1425189
STE20-related kinase adapter protein alphaHomo sapiens (human)Kd30.00000.31601.72083.6720AID1425186
AarF domain-containing protein kinase 1Homo sapiens (human)Kd2.02800.02303.113722.7470AID1424904
Mitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)Kd30.00000.00511.641315.4350AID1425053
MAP kinase-activated protein kinase 5Homo sapiens (human)Kd30.00000.00801.12413.1180AID1425067
Misshapen-like kinase 1Homo sapiens (human)Kd30.00000.00101.14258.9000AID1425077
Atypical kinase COQ8A, mitochondrialHomo sapiens (human)Kd30.00000.09405.167365.3020AID1424905
Phosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)Kd30.00000.00302.75228.8000AID1425115
Mitogen-activated protein kinase 15Homo sapiens (human)Kd30.00000.00490.68804.5000AID1425060
Serine/threonine-protein kinase Nek9Homo sapiens (human)Kd30.00000.01602.742819.6170AID1425089
Serine/threonine-protein kinase Nek7Homo sapiens (human)Kd30.00000.00303.67198.7000AID1425088
ATP-dependent RNA helicase DDX1Homo sapiens (human)Kd30.00000.08600.08600.0860AID1424974
Mitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)Kd30.00000.00100.93785.5000AID1425051
Aurora kinase BHomo sapiens (human)Kd30.00000.00201.061422.8520AID1424918
MAP/microtubule affinity-regulating kinase 4Homo sapiens (human)Kd30.00000.00541.10294.9000AID1425070
Serine/threonine-protein kinase Nek1Homo sapiens (human)Kd30.00000.17002.42948.3000AID1425085
Calcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)Kd3.63300.00003.233152.8470AID1424931
EKC/KEOPS complex subunit TP53RKHomo sapiens (human)Kd30.00000.31101.95193.8400AID1425204
Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)Kd30.00000.04400.92852.9000AID1425116
Mitogen-activated protein kinase kinase kinase 5Homo sapiens (human)Kd30.00000.07006.564750.5360AID1425049
Mitogen-activated protein kinase kinase kinase 3Homo sapiens (human)Kd30.00000.00601.53319.9000AID1425047
Eukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)Kd30.00000.05801.92244.8360AID1424984
Nucleolar GTP-binding protein 1Homo sapiens (human)Kd30.00000.00904.10358.1980AID1425016
Serine/threonine-protein kinase D2Homo sapiens (human)Kd30.00000.00812.372325.0190AID1425136
NUAK family SNF1-like kinase 2Homo sapiens (human)Kd30.00000.00010.67744.6000AID1425095
RNA cytidine acetyltransferaseHomo sapiens (human)Kd30.00001.24001.24001.2400AID1425083
Serine/threonine-protein kinase SIK2Homo sapiens (human)Kd30.00000.00111.816541.7950AID1425166
STE20-like serine/threonine-protein kinase Homo sapiens (human)Kd9.27300.00003.857399.2320AID1425171
Serine/threonine-protein kinase TAO3Homo sapiens (human)Kd30.00000.00022.713114.1960AID1425191
dCTP pyrophosphatase 1Homo sapiens (human)Kd30.00000.57301.74033.0540AID1424971
Dual specificity protein kinase CLK4Homo sapiens (human)Kd30.00000.00201.41228.3000AID1424958
Casein kinase I isoform gamma-1Homo sapiens (human)Kd30.00000.05302.06225.7000AID1424964
Serine/threonine-protein kinase PAK 6Homo sapiens (human)Kd30.00000.00041.91949.7000AID1425101
Phenylalanine--tRNA ligase beta subunitHomo sapiens (human)Kd30.00000.00300.00450.0060AID1425000
Isoleucine--tRNA ligase, mitochondrialHomo sapiens (human)Kd30.00000.01100.01100.0110AID1425020
BMP-2-inducible protein kinaseHomo sapiens (human)Kd6.59000.00222.409756.0320AID1424920
Obg-like ATPase 1Homo sapiens (human)Kd30.00000.00300.00500.0070AID1425096
Interleukin-1 receptor-associated kinase 4Homo sapiens (human)Kd30.00000.00173.471934.1450AID1425029
Mitogen-activated protein kinase kinase kinase 20Homo sapiens (human)Kd30.00000.00231.703413.6380AID1425213
Cyclin-dependent kinase 12Homo sapiens (human)Kd30.00000.03201.80325.6350AID1424939
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)Kd30.00003.92003.92003.9200AID1425084
Serine/threonine-protein kinase pim-2Homo sapiens (human)Kd30.00000.00190.84155.0000AID1425112
Serine/threonine-protein kinase 26Homo sapiens (human)Kd30.00000.00741.73808.3000AID1425181
Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)Kd30.00000.00700.00700.0070AID1425187
Serine/threonine-protein kinase NLKHomo sapiens (human)Kd30.00000.00601.02264.4000AID1425090
5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)Kd30.00000.00501.15819.1280AID1425127
Serine/threonine-protein kinase TBK1Homo sapiens (human)Kd30.00000.00091.767449.6010AID1425192
Septin-9Homo sapiens (human)Kd30.00000.01000.24300.6350AID1425165
Ribosomal protein S6 kinase alpha-6Homo sapiens (human)Kd30.00000.00402.415323.7620AID1425163
TRAF2 and NCK-interacting protein kinaseHomo sapiens (human)Kd30.00000.00471.393510.0000AID1425199
Serine/threonine-protein kinase TAO2Homo sapiens (human)Kd30.00000.01002.017612.9420AID1425190
ALK tyrosine kinase receptorHomo sapiens (human)Kd30.00000.00051.35077.7000AID1424913
Serine/threonine-protein kinase ICKHomo sapiens (human)Kd30.00000.00071.47179.3000AID1425021
RAC-gamma serine/threonine-protein kinaseHomo sapiens (human)Kd30.00000.00251.76466.2000AID1424912
Serine/threonine-protein kinase 38-likeHomo sapiens (human)Kd30.00000.02801.46926.9000AID1425184
Serine/threonine-protein kinase SIK3Homo sapiens (human)Kd30.00000.00051.508610.3180AID1425167
Mitogen-activated protein kinase kinase kinase 2Homo sapiens (human)Kd30.00000.00241.32986.9000AID1425046
Mitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)Kd30.00000.00051.949450.2140AID1425055
Receptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)Kd30.00000.01101.47976.7000AID1425156
Serine/threonine-protein kinase MRCK betaHomo sapiens (human)Kd30.00000.03403.625250.0050AID1424934
Interleukin-1 receptor-associated kinase 3Homo sapiens (human)Kd30.00000.00701.713725.5810AID1425028
Serine/threonine-protein kinase 24Homo sapiens (human)Kd30.00000.00650.89204.0840AID1425180
Casein kinase I isoform gamma-3Homo sapiens (human)Kd30.00000.09702.39788.7000AID1424966
Mitogen-activated protein kinase kinase kinase 4Homo sapiens (human)Kd30.00000.03902.39708.4000AID1425048
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Biological Processes (2536)

Processvia Protein(s)Taxonomy
positive regulation of gene expressionBone morphogenetic protein receptor type-1BHomo sapiens (human)
cartilage condensationBone morphogenetic protein receptor type-1BHomo sapiens (human)
ovarian cumulus expansionBone morphogenetic protein receptor type-1BHomo sapiens (human)
osteoblast differentiationBone morphogenetic protein receptor type-1BHomo sapiens (human)
eye developmentBone morphogenetic protein receptor type-1BHomo sapiens (human)
chondrocyte developmentBone morphogenetic protein receptor type-1BHomo sapiens (human)
inflammatory responseBone morphogenetic protein receptor type-1BHomo sapiens (human)
central nervous system neuron differentiationBone morphogenetic protein receptor type-1BHomo sapiens (human)
proteoglycan biosynthetic processBone morphogenetic protein receptor type-1BHomo sapiens (human)
positive regulation of bone mineralizationBone morphogenetic protein receptor type-1BHomo sapiens (human)
BMP signaling pathwayBone morphogenetic protein receptor type-1BHomo sapiens (human)
retinal ganglion cell axon guidanceBone morphogenetic protein receptor type-1BHomo sapiens (human)
positive regulation of chondrocyte differentiationBone morphogenetic protein receptor type-1BHomo sapiens (human)
ovulation cycleBone morphogenetic protein receptor type-1BHomo sapiens (human)
positive regulation of osteoblast differentiationBone morphogenetic protein receptor type-1BHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIBone morphogenetic protein receptor type-1BHomo sapiens (human)
retina development in camera-type eyeBone morphogenetic protein receptor type-1BHomo sapiens (human)
endochondral bone morphogenesisBone morphogenetic protein receptor type-1BHomo sapiens (human)
positive regulation of cartilage developmentBone morphogenetic protein receptor type-1BHomo sapiens (human)
cellular response to BMP stimulusBone morphogenetic protein receptor type-1BHomo sapiens (human)
positive regulation of extrinsic apoptotic signaling pathway via death domain receptorsBone morphogenetic protein receptor type-1BHomo sapiens (human)
negative regulation of chondrocyte proliferationBone morphogenetic protein receptor type-1BHomo sapiens (human)
dorsal/ventral pattern formationBone morphogenetic protein receptor type-1BHomo sapiens (human)
protein phosphorylationBone morphogenetic protein receptor type-1BHomo sapiens (human)
cellular response to growth factor stimulusBone morphogenetic protein receptor type-1BHomo sapiens (human)
heme biosynthetic processMembrane-associated progesterone receptor component 1Homo sapiens (human)
positive regulation of lipoprotein transportMembrane-associated progesterone receptor component 1Homo sapiens (human)
positive regulation of protein localization to plasma membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
positive regulation of centriole replicationSerine/threonine-protein kinase PLK4Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase PLK4Homo sapiens (human)
centriole replicationSerine/threonine-protein kinase PLK4Homo sapiens (human)
positive regulation of centriole replicationSerine/threonine-protein kinase PLK4Homo sapiens (human)
cilium assemblySerine/threonine-protein kinase PLK4Homo sapiens (human)
trophoblast giant cell differentiationSerine/threonine-protein kinase PLK4Homo sapiens (human)
de novo centriole assembly involved in multi-ciliated epithelial cell differentiationSerine/threonine-protein kinase PLK4Homo sapiens (human)
translational initiationATP-dependent RNA helicase DDX3XHomo sapiens (human)
chromosome segregationATP-dependent RNA helicase DDX3XHomo sapiens (human)
extrinsic apoptotic signaling pathway via death domain receptorsATP-dependent RNA helicase DDX3XHomo sapiens (human)
response to virusATP-dependent RNA helicase DDX3XHomo sapiens (human)
RNA secondary structure unwindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of gene expressionATP-dependent RNA helicase DDX3XHomo sapiens (human)
Wnt signaling pathwayATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of translationATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of cell growthATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of cell growthATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of protein-containing complex assemblyATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of protein autophosphorylationATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of type I interferon productionATP-dependent RNA helicase DDX3XHomo sapiens (human)
DNA duplex unwindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of interferon-alpha productionATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of interferon-beta productionATP-dependent RNA helicase DDX3XHomo sapiens (human)
stress granule assemblyATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of toll-like receptor 7 signaling pathwayATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of toll-like receptor 8 signaling pathwayATP-dependent RNA helicase DDX3XHomo sapiens (human)
intracellular signal transductionATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of translation in response to endoplasmic reticulum stressATP-dependent RNA helicase DDX3XHomo sapiens (human)
cytosolic ribosome assemblyATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of apoptotic processATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of apoptotic processATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in apoptotic processATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of cysteine-type endopeptidase activity involved in apoptotic processATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of viral genome replicationATP-dependent RNA helicase DDX3XHomo sapiens (human)
innate immune responseATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of translationATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of translational initiationATP-dependent RNA helicase DDX3XHomo sapiens (human)
lipid homeostasisATP-dependent RNA helicase DDX3XHomo sapiens (human)
cellular response to arsenic-containing substanceATP-dependent RNA helicase DDX3XHomo sapiens (human)
cellular response to osmotic stressATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of chemokine (C-C motif) ligand 5 productionATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of protein serine/threonine kinase activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of canonical Wnt signaling pathwayATP-dependent RNA helicase DDX3XHomo sapiens (human)
intrinsic apoptotic signaling pathwayATP-dependent RNA helicase DDX3XHomo sapiens (human)
cellular response to virusATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of G1/S transition of mitotic cell cycleATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of NLRP3 inflammasome complex assemblyATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of non-canonical NF-kappaB signal transductionATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of non-canonical NF-kappaB signal transductionATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of protein acetylationATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathway via death domain receptorsATP-dependent RNA helicase DDX3XHomo sapiens (human)
positive regulation of protein K63-linked ubiquitinationATP-dependent RNA helicase DDX3XHomo sapiens (human)
protein localization to cytoplasmic stress granuleATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of intrinsic apoptotic signaling pathwayATP-dependent RNA helicase DDX3XHomo sapiens (human)
negative regulation of gene expressionATP-dependent RNA helicase DDX3XHomo sapiens (human)
gamete generationATP-dependent RNA helicase DDX3XHomo sapiens (human)
cell differentiationATP-dependent RNA helicase DDX3XHomo sapiens (human)
pyridoxal 5'-phosphate salvagePyridoxal kinaseHomo sapiens (human)
pyridoxal metabolic processPyridoxal kinaseHomo sapiens (human)
pyridoxamine metabolic processPyridoxal kinaseHomo sapiens (human)
mitotic cell cycleCitron Rho-interacting kinaseHomo sapiens (human)
mitotic cytokinesisCitron Rho-interacting kinaseHomo sapiens (human)
positive regulation of cytokinesisCitron Rho-interacting kinaseHomo sapiens (human)
negative regulation of hippo signalingCitron Rho-interacting kinaseHomo sapiens (human)
generation of neuronsCitron Rho-interacting kinaseHomo sapiens (human)
neuron apoptotic processCitron Rho-interacting kinaseHomo sapiens (human)
DNA damage checkpoint signalingSerine/threonine-protein kinase Chk1Homo sapiens (human)
G2/M transition of mitotic cell cycleSerine/threonine-protein kinase Chk1Homo sapiens (human)
inner cell mass cell proliferationSerine/threonine-protein kinase Chk1Homo sapiens (human)
DNA replicationSerine/threonine-protein kinase Chk1Homo sapiens (human)
DNA repairSerine/threonine-protein kinase Chk1Homo sapiens (human)
chromatin remodelingSerine/threonine-protein kinase Chk1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase Chk1Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase Chk1Homo sapiens (human)
DNA damage responseSerine/threonine-protein kinase Chk1Homo sapiens (human)
nucleus organizationSerine/threonine-protein kinase Chk1Homo sapiens (human)
mitotic G2 DNA damage checkpoint signalingSerine/threonine-protein kinase Chk1Homo sapiens (human)
regulation of double-strand break repair via homologous recombinationSerine/threonine-protein kinase Chk1Homo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase Chk1Homo sapiens (human)
regulation of cell population proliferationSerine/threonine-protein kinase Chk1Homo sapiens (human)
signal transduction in response to DNA damageSerine/threonine-protein kinase Chk1Homo sapiens (human)
mitotic G2/M transition checkpointSerine/threonine-protein kinase Chk1Homo sapiens (human)
positive regulation of cell cycleSerine/threonine-protein kinase Chk1Homo sapiens (human)
negative regulation of gene expression, epigeneticSerine/threonine-protein kinase Chk1Homo sapiens (human)
negative regulation of mitotic nuclear divisionSerine/threonine-protein kinase Chk1Homo sapiens (human)
regulation of mitotic centrosome separationSerine/threonine-protein kinase Chk1Homo sapiens (human)
negative regulation of G0 to G1 transitionSerine/threonine-protein kinase Chk1Homo sapiens (human)
cellular response to mechanical stimulusSerine/threonine-protein kinase Chk1Homo sapiens (human)
cellular response to caffeineSerine/threonine-protein kinase Chk1Homo sapiens (human)
replicative senescenceSerine/threonine-protein kinase Chk1Homo sapiens (human)
regulation of signal transduction by p53 class mediatorSerine/threonine-protein kinase Chk1Homo sapiens (human)
apoptotic process involved in developmentSerine/threonine-protein kinase Chk1Homo sapiens (human)
negative regulation of DNA biosynthetic processSerine/threonine-protein kinase Chk1Homo sapiens (human)
protein phosphorylationAurora kinase AHomo sapiens (human)
response to woundingAurora kinase AHomo sapiens (human)
liver regenerationAurora kinase AHomo sapiens (human)
G2/M transition of mitotic cell cycleAurora kinase AHomo sapiens (human)
mitotic cell cycleAurora kinase AHomo sapiens (human)
chromatin remodelingAurora kinase AHomo sapiens (human)
protein phosphorylationAurora kinase AHomo sapiens (human)
apoptotic processAurora kinase AHomo sapiens (human)
spindle organizationAurora kinase AHomo sapiens (human)
spindle assembly involved in female meiosis IAurora kinase AHomo sapiens (human)
mitotic centrosome separationAurora kinase AHomo sapiens (human)
anterior/posterior axis specificationAurora kinase AHomo sapiens (human)
regulation of G2/M transition of mitotic cell cycleAurora kinase AHomo sapiens (human)
negative regulation of gene expressionAurora kinase AHomo sapiens (human)
peptidyl-serine phosphorylationAurora kinase AHomo sapiens (human)
regulation of protein stabilityAurora kinase AHomo sapiens (human)
negative regulation of protein bindingAurora kinase AHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processAurora kinase AHomo sapiens (human)
negative regulation of apoptotic processAurora kinase AHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processAurora kinase AHomo sapiens (human)
positive regulation of mitotic nuclear divisionAurora kinase AHomo sapiens (human)
positive regulation of mitotic cell cycleAurora kinase AHomo sapiens (human)
regulation of centrosome cycleAurora kinase AHomo sapiens (human)
protein autophosphorylationAurora kinase AHomo sapiens (human)
cell divisionAurora kinase AHomo sapiens (human)
centrosome localizationAurora kinase AHomo sapiens (human)
cilium disassemblyAurora kinase AHomo sapiens (human)
protein localization to centrosomeAurora kinase AHomo sapiens (human)
positive regulation of mitochondrial fissionAurora kinase AHomo sapiens (human)
positive regulation of oocyte maturationAurora kinase AHomo sapiens (human)
regulation of signal transduction by p53 class mediatorAurora kinase AHomo sapiens (human)
neuron projection extensionAurora kinase AHomo sapiens (human)
mitotic spindle organizationAurora kinase AHomo sapiens (human)
regulation of cytokinesisAurora kinase AHomo sapiens (human)
receptor-mediated endocytosisCyclin-G-associated kinaseHomo sapiens (human)
endoplasmic reticulum organizationCyclin-G-associated kinaseHomo sapiens (human)
Golgi organizationCyclin-G-associated kinaseHomo sapiens (human)
negative regulation of neuron projection developmentCyclin-G-associated kinaseHomo sapiens (human)
synaptic vesicle uncoatingCyclin-G-associated kinaseHomo sapiens (human)
protein localization to Golgi apparatusCyclin-G-associated kinaseHomo sapiens (human)
intracellular transportCyclin-G-associated kinaseHomo sapiens (human)
clathrin coat assemblyCyclin-G-associated kinaseHomo sapiens (human)
chaperone cofactor-dependent protein refoldingCyclin-G-associated kinaseHomo sapiens (human)
clathrin coat disassemblyCyclin-G-associated kinaseHomo sapiens (human)
clathrin-dependent endocytosisCyclin-G-associated kinaseHomo sapiens (human)
protein localization to plasma membraneCyclin-G-associated kinaseHomo sapiens (human)
Golgi to lysosome transportCyclin-G-associated kinaseHomo sapiens (human)
regulation of clathrin coat assemblyCyclin-G-associated kinaseHomo sapiens (human)
protein phosphorylationEphrin type-B receptor 6Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-B receptor 6Homo sapiens (human)
axon guidanceEphrin type-B receptor 6Homo sapiens (human)
fatty acid beta-oxidation using acyl-CoA oxidasePeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
lipid homeostasisPeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
toll-like receptor 2 signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of cytokine-mediated signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
adaptive immune responseReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of T-helper 1 type immune responseReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
apoptotic processReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
inflammatory responseReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
signal transductionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
canonical NF-kappaB signal transductionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
JNK cascadeReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of peptidyl-threonine phosphorylationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
cytokine-mediated signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of protein ubiquitinationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
lipopolysaccharide-mediated signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of protein bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of chemokine productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of interferon-alpha productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of interferon-beta productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of type II interferon productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of interleukin-1 beta productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of interleukin-12 productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of interleukin-2 productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of interleukin-6 productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of tumor necrosis factor productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of stress-activated MAPK cascadeReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
immature T cell proliferation in thymusReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of immature T cell proliferation in thymusReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of peptidyl-serine phosphorylationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
toll-like receptor 4 signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
CD4-positive, alpha-beta T cell proliferationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
defense response to bacteriumReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of apoptotic processReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
response to exogenous dsRNAReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
innate immune responseReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of T-helper 1 cell differentiationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of JNK cascadeReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
defense response to Gram-positive bacteriumReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
T cell receptor signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
protein homooligomerizationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
stress-activated MAPK cascadeReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of macrophage cytokine productionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
ERK1 and ERK2 cascadeReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
nucleotide-binding oligomerization domain containing 1 signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
nucleotide-binding oligomerization domain containing 2 signaling pathwayReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
response to interleukin-1Receptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
response to interleukin-12Receptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
response to interleukin-18Receptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
cellular response to lipoteichoic acidReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
cellular response to peptidoglycanReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
cellular response to muramyl dipeptideReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
activation of cysteine-type endopeptidase activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
xenophagyReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of protein K63-linked ubiquitinationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of xenophagyReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of CD4-positive, alpha-beta T cell proliferationReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
chromatin remodelingMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
apoptotic processMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
chromosome segregationMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
regulation of sister chromatid cohesionMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
mitotic spindle assembly checkpoint signalingMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
cell divisionMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
regulation of chromosome segregationMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
positive regulation of maintenance of mitotic sister chromatid cohesion, centromericMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
meiotic sister chromatid cohesion, centromericMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
mitochondrion organizationDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial genome maintenanceDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial fissionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
neural tube closureDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
apoptotic processDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrion organizationDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
inner mitochondrial membrane organizationDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
visual perceptionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial fusionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
axonal transport of mitochondrionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
positive regulation of interleukin-17 productionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
cristae formationDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
negative regulation of apoptotic processDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
GTP metabolic processDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
protein complex oligomerizationDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
membrane fusionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
negative regulation of release of cytochrome c from mitochondriaDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
cellular senescenceDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
membrane tubulationDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathwayDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial inner membrane fusionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
positive regulation of T-helper 17 cell lineage commitmentDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
positive regulation of platelet aggregationTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of platelet activationTyrosine-protein kinase JAK2Homo sapiens (human)
response to antibioticTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of SMAD protein signal transductionTyrosine-protein kinase JAK2Homo sapiens (human)
microglial cell activationTyrosine-protein kinase JAK2Homo sapiens (human)
adaptive immune responseTyrosine-protein kinase JAK2Homo sapiens (human)
chromatin remodelingTyrosine-protein kinase JAK2Homo sapiens (human)
transcription by RNA polymerase IITyrosine-protein kinase JAK2Homo sapiens (human)
protein phosphorylationTyrosine-protein kinase JAK2Homo sapiens (human)
apoptotic processTyrosine-protein kinase JAK2Homo sapiens (human)
activation of cysteine-type endopeptidase activity involved in apoptotic processTyrosine-protein kinase JAK2Homo sapiens (human)
immune responseTyrosine-protein kinase JAK2Homo sapiens (human)
signal transductionTyrosine-protein kinase JAK2Homo sapiens (human)
enzyme-linked receptor protein signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
G protein-coupled receptor signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of cytosolic calcium ion concentrationTyrosine-protein kinase JAK2Homo sapiens (human)
cell surface receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK2Homo sapiens (human)
tyrosine phosphorylation of STAT proteinTyrosine-protein kinase JAK2Homo sapiens (human)
mesoderm developmentTyrosine-protein kinase JAK2Homo sapiens (human)
negative regulation of cell population proliferationTyrosine-protein kinase JAK2Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to oxidative stressTyrosine-protein kinase JAK2Homo sapiens (human)
negative regulation of cardiac muscle cell apoptotic processTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of cell-substrate adhesionTyrosine-protein kinase JAK2Homo sapiens (human)
response to amineTyrosine-protein kinase JAK2Homo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase JAK2Homo sapiens (human)
cytokine-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
negative regulation of cell-cell adhesionTyrosine-protein kinase JAK2Homo sapiens (human)
actin filament polymerizationTyrosine-protein kinase JAK2Homo sapiens (human)
cell differentiationTyrosine-protein kinase JAK2Homo sapiens (human)
erythrocyte differentiationTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of cell migrationTyrosine-protein kinase JAK2Homo sapiens (human)
axon regenerationTyrosine-protein kinase JAK2Homo sapiens (human)
intracellular mineralocorticoid receptor signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of insulin secretionTyrosine-protein kinase JAK2Homo sapiens (human)
response to lipopolysaccharideTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of type II interferon productionTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of interleukin-1 beta productionTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of interleukin-17 productionTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of tumor necrosis factor productionTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of natural killer cell proliferationTyrosine-protein kinase JAK2Homo sapiens (human)
response to hydroperoxideTyrosine-protein kinase JAK2Homo sapiens (human)
tumor necrosis factor-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
symbiont-induced defense-related programmed cell deathTyrosine-protein kinase JAK2Homo sapiens (human)
response to tumor necrosis factorTyrosine-protein kinase JAK2Homo sapiens (human)
post-embryonic hemopoiesisTyrosine-protein kinase JAK2Homo sapiens (human)
intracellular signal transductionTyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-12-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
cellular response to interleukin-3Tyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-5-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
collagen-activated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-3-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
granulocyte-macrophage colony-stimulating factor signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of T cell proliferationTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of protein import into nucleusTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of tyrosine phosphorylation of STAT proteinTyrosine-protein kinase JAK2Homo sapiens (human)
activation of Janus kinase activityTyrosine-protein kinase JAK2Homo sapiens (human)
negative regulation of DNA bindingTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of MAPK cascadeTyrosine-protein kinase JAK2Homo sapiens (human)
negative regulation of neuron apoptotic processTyrosine-protein kinase JAK2Homo sapiens (human)
post-translational protein modificationTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of MHC class II biosynthetic processTyrosine-protein kinase JAK2Homo sapiens (human)
regulation of nitric oxide biosynthetic processTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of nitric oxide biosynthetic processTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of cell differentiationTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of transcription by RNA polymerase IITyrosine-protein kinase JAK2Homo sapiens (human)
regulation of receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK2Homo sapiens (human)
protein autophosphorylationTyrosine-protein kinase JAK2Homo sapiens (human)
platelet-derived growth factor receptor signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
regulation of inflammatory responseTyrosine-protein kinase JAK2Homo sapiens (human)
modulation of chemical synaptic transmissionTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of NK T cell proliferationTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of nitric-oxide synthase biosynthetic processTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionTyrosine-protein kinase JAK2Homo sapiens (human)
type II interferon-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
growth hormone receptor signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
growth hormone receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of growth hormone receptor signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
mammary gland epithelium developmentTyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-6-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of leukocyte proliferationTyrosine-protein kinase JAK2Homo sapiens (human)
response to interleukin-12Tyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-35-mediated signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
cellular response to lipopolysaccharideTyrosine-protein kinase JAK2Homo sapiens (human)
cellular response to dexamethasone stimulusTyrosine-protein kinase JAK2Homo sapiens (human)
extrinsic apoptotic signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
cellular response to virusTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of cold-induced thermogenesisTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of growth factor dependent skeletal muscle satellite cell proliferationTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of epithelial cell apoptotic processTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationTyrosine-protein kinase JAK2Homo sapiens (human)
regulation of postsynapse to nucleus signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of signaling receptor activityTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of T-helper 17 type immune responseTyrosine-protein kinase JAK2Homo sapiens (human)
positive regulation of apoptotic signaling pathwayTyrosine-protein kinase JAK2Homo sapiens (human)
regulation of apoptotic processTyrosine-protein kinase JAK2Homo sapiens (human)
regulation of translational initiationEukaryotic translation initiation factor 5BHomo sapiens (human)
ribosome assemblyEukaryotic translation initiation factor 5BHomo sapiens (human)
translational initiationEukaryotic translation initiation factor 5BHomo sapiens (human)
epithelial to mesenchymal transitionRho-associated protein kinase 2Homo sapiens (human)
positive regulation of protein phosphorylationRho-associated protein kinase 2Homo sapiens (human)
response to ischemiaRho-associated protein kinase 2Homo sapiens (human)
aortic valve morphogenesisRho-associated protein kinase 2Homo sapiens (human)
protein phosphorylationRho-associated protein kinase 2Homo sapiens (human)
smooth muscle contractionRho-associated protein kinase 2Homo sapiens (human)
canonical NF-kappaB signal transductionRho-associated protein kinase 2Homo sapiens (human)
positive regulation of endothelial cell migrationRho-associated protein kinase 2Homo sapiens (human)
positive regulation of cardiac muscle hypertrophyRho-associated protein kinase 2Homo sapiens (human)
positive regulation of gene expressionRho-associated protein kinase 2Homo sapiens (human)
negative regulation of gene expressionRho-associated protein kinase 2Homo sapiens (human)
positive regulation of centrosome duplicationRho-associated protein kinase 2Homo sapiens (human)
negative regulation of angiogenesisRho-associated protein kinase 2Homo sapiens (human)
actin cytoskeleton organizationRho-associated protein kinase 2Homo sapiens (human)
regulation of cell adhesionRho-associated protein kinase 2Homo sapiens (human)
positive regulation of cell migrationRho-associated protein kinase 2Homo sapiens (human)
cortical actin cytoskeleton organizationRho-associated protein kinase 2Homo sapiens (human)
regulation of nervous system processRho-associated protein kinase 2Homo sapiens (human)
positive regulation of connective tissue growth factor productionRho-associated protein kinase 2Homo sapiens (human)
regulation of actin cytoskeleton organizationRho-associated protein kinase 2Homo sapiens (human)
negative regulation of myosin-light-chain-phosphatase activityRho-associated protein kinase 2Homo sapiens (human)
regulation of circadian rhythmRho-associated protein kinase 2Homo sapiens (human)
positive regulation of MAPK cascadeRho-associated protein kinase 2Homo sapiens (human)
modulation by host of viral processRho-associated protein kinase 2Homo sapiens (human)
negative regulation of nitric oxide biosynthetic processRho-associated protein kinase 2Homo sapiens (human)
regulation of keratinocyte differentiationRho-associated protein kinase 2Homo sapiens (human)
rhythmic processRho-associated protein kinase 2Homo sapiens (human)
centrosome duplicationRho-associated protein kinase 2Homo sapiens (human)
regulation of stress fiber assemblyRho-associated protein kinase 2Homo sapiens (human)
positive regulation of stress fiber assemblyRho-associated protein kinase 2Homo sapiens (human)
regulation of focal adhesion assemblyRho-associated protein kinase 2Homo sapiens (human)
mRNA destabilizationRho-associated protein kinase 2Homo sapiens (human)
negative regulation of biomineral tissue developmentRho-associated protein kinase 2Homo sapiens (human)
cellular response to testosterone stimulusRho-associated protein kinase 2Homo sapiens (human)
response to transforming growth factor betaRho-associated protein kinase 2Homo sapiens (human)
protein localization to plasma membraneRho-associated protein kinase 2Homo sapiens (human)
positive regulation of fibroblast growth factor productionRho-associated protein kinase 2Homo sapiens (human)
blood vessel diameter maintenanceRho-associated protein kinase 2Homo sapiens (human)
regulation of angiotensin-activated signaling pathwayRho-associated protein kinase 2Homo sapiens (human)
negative regulation of protein localization to lysosomeRho-associated protein kinase 2Homo sapiens (human)
regulation of cellular response to hypoxiaRho-associated protein kinase 2Homo sapiens (human)
positive regulation of amyloid-beta formationRho-associated protein kinase 2Homo sapiens (human)
positive regulation of protein localization to early endosomeRho-associated protein kinase 2Homo sapiens (human)
positive regulation of amyloid precursor protein catabolic processRho-associated protein kinase 2Homo sapiens (human)
regulation of establishment of endothelial barrierRho-associated protein kinase 2Homo sapiens (human)
negative regulation of bicellular tight junction assemblyRho-associated protein kinase 2Homo sapiens (human)
cellular response to acetylcholineRho-associated protein kinase 2Homo sapiens (human)
positive regulation of connective tissue replacementRho-associated protein kinase 2Homo sapiens (human)
response to angiotensinRho-associated protein kinase 2Homo sapiens (human)
regulation of establishment of cell polarityRho-associated protein kinase 2Homo sapiens (human)
regulation of cell motilityRho-associated protein kinase 2Homo sapiens (human)
actomyosin structure organizationRho-associated protein kinase 2Homo sapiens (human)
peptidyl-threonine phosphorylationRho-associated protein kinase 2Homo sapiens (human)
mitotic cytokinesisRho-associated protein kinase 2Homo sapiens (human)
embryonic morphogenesisRho-associated protein kinase 2Homo sapiens (human)
regulation of cell junction assemblyRho-associated protein kinase 2Homo sapiens (human)
Rho protein signal transductionRho-associated protein kinase 2Homo sapiens (human)
autophagosome assemblySerine/threonine-protein kinase ULK1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase ULK1Homo sapiens (human)
autophagySerine/threonine-protein kinase ULK1Homo sapiens (human)
signal transductionSerine/threonine-protein kinase ULK1Homo sapiens (human)
protein localizationSerine/threonine-protein kinase ULK1Homo sapiens (human)
negative regulation of cell population proliferationSerine/threonine-protein kinase ULK1Homo sapiens (human)
positive regulation of autophagySerine/threonine-protein kinase ULK1Homo sapiens (human)
regulation of tumor necrosis factor-mediated signaling pathwaySerine/threonine-protein kinase ULK1Homo sapiens (human)
macroautophagySerine/threonine-protein kinase ULK1Homo sapiens (human)
regulation of macroautophagySerine/threonine-protein kinase ULK1Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase ULK1Homo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase ULK1Homo sapiens (human)
neuron projection regenerationSerine/threonine-protein kinase ULK1Homo sapiens (human)
neuron projection developmentSerine/threonine-protein kinase ULK1Homo sapiens (human)
negative regulation of protein-containing complex assemblySerine/threonine-protein kinase ULK1Homo sapiens (human)
cellular response to nutrient levelsSerine/threonine-protein kinase ULK1Homo sapiens (human)
response to starvationSerine/threonine-protein kinase ULK1Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase ULK1Homo sapiens (human)
regulation of protein lipidationSerine/threonine-protein kinase ULK1Homo sapiens (human)
positive regulation of autophagosome assemblySerine/threonine-protein kinase ULK1Homo sapiens (human)
axon extensionSerine/threonine-protein kinase ULK1Homo sapiens (human)
autophagy of mitochondrionSerine/threonine-protein kinase ULK1Homo sapiens (human)
reticulophagySerine/threonine-protein kinase ULK1Homo sapiens (human)
piecemeal microautophagy of the nucleusSerine/threonine-protein kinase ULK1Homo sapiens (human)
negative regulation of collateral sproutingSerine/threonine-protein kinase ULK1Homo sapiens (human)
endothelial cell proliferationSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
mRNA catabolic processSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
regulation of macroautophagySerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
positive regulation of RNA splicingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
cellular response to unfolded proteinSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
response to endoplasmic reticulum stressSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
cellular response to vascular endothelial growth factor stimulusSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
peptidyl-serine autophosphorylationSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
IRE1-mediated unfolded protein responseSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
positive regulation of JUN kinase activitySerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
mRNA splicing, via endonucleolytic cleavage and ligationSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stressSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
cellular response to hydrogen peroxideSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
cellular response to glucose stimulusSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
positive regulation of endoplasmic reticulum unfolded protein responseSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
insulin metabolic processSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
peptidyl-serine trans-autophosphorylationSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
negative regulation of cytokine productionRibosomal protein S6 kinase alpha-5Homo sapiens (human)
chromatin remodelingRibosomal protein S6 kinase alpha-5Homo sapiens (human)
regulation of DNA-templated transcriptionRibosomal protein S6 kinase alpha-5Homo sapiens (human)
protein phosphorylationRibosomal protein S6 kinase alpha-5Homo sapiens (human)
inflammatory responseRibosomal protein S6 kinase alpha-5Homo sapiens (human)
axon guidanceRibosomal protein S6 kinase alpha-5Homo sapiens (human)
positive regulation of CREB transcription factor activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
intracellular signal transductionRibosomal protein S6 kinase alpha-5Homo sapiens (human)
post-translational protein modificationRibosomal protein S6 kinase alpha-5Homo sapiens (human)
negative regulation of DNA-templated transcriptionRibosomal protein S6 kinase alpha-5Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIRibosomal protein S6 kinase alpha-5Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
interleukin-1-mediated signaling pathwayRibosomal protein S6 kinase alpha-5Homo sapiens (human)
regulation of postsynapse organizationRibosomal protein S6 kinase alpha-5Homo sapiens (human)
peptidyl-serine phosphorylationRibosomal protein S6 kinase alpha-5Homo sapiens (human)
cis assembly of pre-catalytic spliceosomeU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
spliceosome conformational change to release U4 (or U4atac) and U1 (or U11)U5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
mRNA splicing, via spliceosomeU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
osteoblast differentiationU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
negative regulation of cytokine productionRibosomal protein S6 kinase alpha-4Homo sapiens (human)
chromatin remodelingRibosomal protein S6 kinase alpha-4Homo sapiens (human)
regulation of DNA-templated transcriptionRibosomal protein S6 kinase alpha-4Homo sapiens (human)
protein phosphorylationRibosomal protein S6 kinase alpha-4Homo sapiens (human)
inflammatory responseRibosomal protein S6 kinase alpha-4Homo sapiens (human)
positive regulation of CREB transcription factor activityRibosomal protein S6 kinase alpha-4Homo sapiens (human)
intracellular signal transductionRibosomal protein S6 kinase alpha-4Homo sapiens (human)
post-translational protein modificationRibosomal protein S6 kinase alpha-4Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIRibosomal protein S6 kinase alpha-4Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityRibosomal protein S6 kinase alpha-4Homo sapiens (human)
interleukin-1-mediated signaling pathwayRibosomal protein S6 kinase alpha-4Homo sapiens (human)
peptidyl-serine phosphorylationRibosomal protein S6 kinase alpha-4Homo sapiens (human)
positive regulation of transcription by RNA polymerase IISerine/threonine-protein kinase 16Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase 16Homo sapiens (human)
cellular response to transforming growth factor beta stimulusSerine/threonine-protein kinase 16Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 10Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase 10Homo sapiens (human)
lymphocyte aggregationSerine/threonine-protein kinase 10Homo sapiens (human)
regulation of lymphocyte migrationSerine/threonine-protein kinase 10Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase D3Homo sapiens (human)
protein kinase C-activating G protein-coupled receptor signaling pathwaySerine/threonine-protein kinase D3Homo sapiens (human)
sphingolipid biosynthetic processSerine/threonine-protein kinase D3Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase D3Homo sapiens (human)
phospholipase C-activating G protein-coupled receptor signaling pathwaySerine/threonine-protein kinase D3Homo sapiens (human)
mitotic chromosome condensationStructural maintenance of chromosomes protein 2Homo sapiens (human)
meiotic chromosome condensationStructural maintenance of chromosomes protein 2Homo sapiens (human)
meiotic chromosome segregationStructural maintenance of chromosomes protein 2Homo sapiens (human)
cell divisionStructural maintenance of chromosomes protein 2Homo sapiens (human)
kinetochore organizationStructural maintenance of chromosomes protein 2Homo sapiens (human)
positive regulation of chromosome segregationStructural maintenance of chromosomes protein 2Homo sapiens (human)
positive regulation of chromosome separationStructural maintenance of chromosomes protein 2Homo sapiens (human)
positive regulation of chromosome condensationStructural maintenance of chromosomes protein 2Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
signal transductionMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
cellular response to stressMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
microvillus assemblyMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
negative regulation of cell-matrix adhesionMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
positive regulation of cell migrationMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
positive regulation of ARF protein signal transductionMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
positive regulation of hippo signalingMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
negative regulation of apoptotic processMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
positive regulation of GTPase activityMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
regulation of JNK cascadeMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
positive regulation of keratinocyte migrationMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
positive regulation of focal adhesion assemblyMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
positive regulation of focal adhesion disassemblyMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
regulation of MAPK cascadeMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
neuron projection morphogenesisMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
G2/M transition of mitotic cell cycleSerine/threonine-protein kinase LATS1Homo sapiens (human)
sister chromatid segregationSerine/threonine-protein kinase LATS1Homo sapiens (human)
inner cell mass cell fate commitmentSerine/threonine-protein kinase LATS1Homo sapiens (human)
inner cell mass cellular morphogenesisSerine/threonine-protein kinase LATS1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase LATS1Homo sapiens (human)
hormone-mediated signaling pathwaySerine/threonine-protein kinase LATS1Homo sapiens (human)
regulation of transforming growth factor beta receptor signaling pathwaySerine/threonine-protein kinase LATS1Homo sapiens (human)
keratinocyte differentiationSerine/threonine-protein kinase LATS1Homo sapiens (human)
regulation of actin filament polymerizationSerine/threonine-protein kinase LATS1Homo sapiens (human)
positive regulation of peptidyl-serine phosphorylationSerine/threonine-protein kinase LATS1Homo sapiens (human)
regulation of intracellular estrogen receptor signaling pathwaySerine/threonine-protein kinase LATS1Homo sapiens (human)
hippo signalingSerine/threonine-protein kinase LATS1Homo sapiens (human)
regulation of protein-containing complex assemblySerine/threonine-protein kinase LATS1Homo sapiens (human)
negative regulation of cyclin-dependent protein serine/threonine kinase activitySerine/threonine-protein kinase LATS1Homo sapiens (human)
cytoplasmic sequestering of proteinSerine/threonine-protein kinase LATS1Homo sapiens (human)
cell divisionSerine/threonine-protein kinase LATS1Homo sapiens (human)
mammary gland epithelial cell differentiationSerine/threonine-protein kinase LATS1Homo sapiens (human)
negative regulation of canonical Wnt signaling pathwaySerine/threonine-protein kinase LATS1Homo sapiens (human)
negative regulation of protein localization to nucleusSerine/threonine-protein kinase LATS1Homo sapiens (human)
regulation of ubiquitin-dependent protein catabolic processSerine/threonine-protein kinase LATS1Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase LATS1Homo sapiens (human)
G1/S transition of mitotic cell cycleSerine/threonine-protein kinase LATS1Homo sapiens (human)
positive regulation of apoptotic processSerine/threonine-protein kinase LATS1Homo sapiens (human)
regulation of organ growthSerine/threonine-protein kinase LATS1Homo sapiens (human)
regulation of cell growthSerine/threonine-protein kinase PAK 4Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase PAK 4Homo sapiens (human)
cytoskeleton organizationSerine/threonine-protein kinase PAK 4Homo sapiens (human)
signal transductionSerine/threonine-protein kinase PAK 4Homo sapiens (human)
cell migrationSerine/threonine-protein kinase PAK 4Homo sapiens (human)
positive regulation of angiogenesisSerine/threonine-protein kinase PAK 4Homo sapiens (human)
dendritic spine developmentSerine/threonine-protein kinase PAK 4Homo sapiens (human)
cellular response to organic cyclic compoundSerine/threonine-protein kinase PAK 4Homo sapiens (human)
cell-cell adhesionSerine/threonine-protein kinase PAK 4Homo sapiens (human)
negative regulation of endothelial cell apoptotic processSerine/threonine-protein kinase PAK 4Homo sapiens (human)
regulation of MAPK cascadeSerine/threonine-protein kinase PAK 4Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase PAK 4Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase PAK 4Homo sapiens (human)
response to oxidative stressTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of cytosolic calcium ion concentrationTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of ubiquitin-protein transferase activityTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of phospholipase C activityTyrosine-protein kinase ABL1Homo sapiens (human)
mitotic cell cycleTyrosine-protein kinase ABL1Homo sapiens (human)
neural tube closureTyrosine-protein kinase ABL1Homo sapiens (human)
B-1 B cell homeostasisTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of protein phosphorylationTyrosine-protein kinase ABL1Homo sapiens (human)
B cell proliferation involved in immune responseTyrosine-protein kinase ABL1Homo sapiens (human)
transitional one stage B cell differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
mismatch repairTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of DNA-templated transcriptionTyrosine-protein kinase ABL1Homo sapiens (human)
autophagyTyrosine-protein kinase ABL1Homo sapiens (human)
DNA damage responseTyrosine-protein kinase ABL1Homo sapiens (human)
integrin-mediated signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
canonical NF-kappaB signal transductionTyrosine-protein kinase ABL1Homo sapiens (human)
associative learningTyrosine-protein kinase ABL1Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to DNA damageTyrosine-protein kinase ABL1Homo sapiens (human)
response to xenobiotic stimulusTyrosine-protein kinase ABL1Homo sapiens (human)
post-embryonic developmentTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of autophagyTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of endothelial cell migrationTyrosine-protein kinase ABL1Homo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase ABL1Homo sapiens (human)
cerebellum morphogenesisTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of cell-cell adhesionTyrosine-protein kinase ABL1Homo sapiens (human)
microspike assemblyTyrosine-protein kinase ABL1Homo sapiens (human)
actin cytoskeleton organizationTyrosine-protein kinase ABL1Homo sapiens (human)
actin filament polymerizationTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of endocytosisTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of cell adhesionTyrosine-protein kinase ABL1Homo sapiens (human)
neuron differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
BMP signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of BMP signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of axon extensionTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of microtubule polymerizationTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of Cdc42 protein signal transductionTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of type II interferon productionTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of interleukin-2 productionTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of actin cytoskeleton organizationTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of osteoblast proliferationTyrosine-protein kinase ABL1Homo sapiens (human)
substrate adhesion-dependent cell spreadingTyrosine-protein kinase ABL1Homo sapiens (human)
cellular response to oxidative stressTyrosine-protein kinase ABL1Homo sapiens (human)
response to endoplasmic reticulum stressTyrosine-protein kinase ABL1Homo sapiens (human)
platelet-derived growth factor receptor-beta signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
protein modification processTyrosine-protein kinase ABL1Homo sapiens (human)
peptidyl-tyrosine autophosphorylationTyrosine-protein kinase ABL1Homo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisTyrosine-protein kinase ABL1Homo sapiens (human)
neuropilin signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
signal transduction in response to DNA damageTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of apoptotic processTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of neuron apoptotic processTyrosine-protein kinase ABL1Homo sapiens (human)
endothelial cell migrationTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of T cell differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of vasoconstrictionTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of mitotic cell cycleTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of mitotic cell cycleTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of transcription by RNA polymerase IITyrosine-protein kinase ABL1Homo sapiens (human)
alpha-beta T cell differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
protein autophosphorylationTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of fibroblast proliferationTyrosine-protein kinase ABL1Homo sapiens (human)
spleen developmentTyrosine-protein kinase ABL1Homo sapiens (human)
thymus developmentTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationTyrosine-protein kinase ABL1Homo sapiens (human)
activated T cell proliferationTyrosine-protein kinase ABL1Homo sapiens (human)
T cell receptor signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
B cell receptor signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
neuromuscular process controlling balanceTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of release of sequestered calcium ion into cytosolTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of oxidoreductase activityTyrosine-protein kinase ABL1Homo sapiens (human)
neuron apoptotic processTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of ubiquitin-protein transferase activityTyrosine-protein kinase ABL1Homo sapiens (human)
myoblast proliferationTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of stress fiber assemblyTyrosine-protein kinase ABL1Homo sapiens (human)
establishment of localization in cellTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of cell cycleTyrosine-protein kinase ABL1Homo sapiens (human)
mitochondrial depolarizationTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of focal adhesion assemblyTyrosine-protein kinase ABL1Homo sapiens (human)
Bergmann glial cell differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
cardiac muscle cell proliferationTyrosine-protein kinase ABL1Homo sapiens (human)
neuroepithelial cell differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
cellular response to hydrogen peroxideTyrosine-protein kinase ABL1Homo sapiens (human)
ERK1 and ERK2 cascadeTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of ERK1 and ERK2 cascadeTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeTyrosine-protein kinase ABL1Homo sapiens (human)
DNA conformation changeTyrosine-protein kinase ABL1Homo sapiens (human)
cellular response to lipopolysaccharideTyrosine-protein kinase ABL1Homo sapiens (human)
cellular response to transforming growth factor beta stimulusTyrosine-protein kinase ABL1Homo sapiens (human)
response to epinephrineTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of protein serine/threonine kinase activityTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of cell migration involved in sprouting angiogenesisTyrosine-protein kinase ABL1Homo sapiens (human)
cellular senescenceTyrosine-protein kinase ABL1Homo sapiens (human)
cell-cell adhesionTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of dendrite developmentTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of substrate adhesion-dependent cell spreadingTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of long-term synaptic potentiationTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of hematopoietic stem cell differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of extracellular matrix organizationTyrosine-protein kinase ABL1Homo sapiens (human)
podocyte apoptotic processTyrosine-protein kinase ABL1Homo sapiens (human)
cellular response to dopamineTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of establishment of T cell polarityTyrosine-protein kinase ABL1Homo sapiens (human)
DN4 thymocyte differentiationTyrosine-protein kinase ABL1Homo sapiens (human)
protein localization to cytoplasmic microtubule plus-endTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of microtubule bindingTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of actin filament bindingTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of modification of synaptic structureTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of blood vessel branchingTyrosine-protein kinase ABL1Homo sapiens (human)
activation of protein kinase C activityTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of double-strand break repair via homologous recombinationTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of Wnt signaling pathway, planar cell polarity pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
regulation of cell motilityTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of endothelial cell apoptotic processTyrosine-protein kinase ABL1Homo sapiens (human)
positive regulation of T cell migrationTyrosine-protein kinase ABL1Homo sapiens (human)
negative regulation of cellular senescenceTyrosine-protein kinase ABL1Homo sapiens (human)
epidermal growth factor receptor signaling pathwayTyrosine-protein kinase ABL1Homo sapiens (human)
protein phosphorylationTyrosine-protein kinase ABL1Homo sapiens (human)
cell surface receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell population proliferationEpidermal growth factor receptorHomo sapiens (human)
MAPK cascadeEpidermal growth factor receptorHomo sapiens (human)
ossificationEpidermal growth factor receptorHomo sapiens (human)
embryonic placenta developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of protein phosphorylationEpidermal growth factor receptorHomo sapiens (human)
hair follicle developmentEpidermal growth factor receptorHomo sapiens (human)
translationEpidermal growth factor receptorHomo sapiens (human)
signal transductionEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
activation of phospholipase C activityEpidermal growth factor receptorHomo sapiens (human)
salivary gland morphogenesisEpidermal growth factor receptorHomo sapiens (human)
midgut developmentEpidermal growth factor receptorHomo sapiens (human)
learning or memoryEpidermal growth factor receptorHomo sapiens (human)
circadian rhythmEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell population proliferationEpidermal growth factor receptorHomo sapiens (human)
diterpenoid metabolic processEpidermal growth factor receptorHomo sapiens (human)
peptidyl-tyrosine phosphorylationEpidermal growth factor receptorHomo sapiens (human)
cerebral cortex cell migrationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell growthEpidermal growth factor receptorHomo sapiens (human)
lung developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell migrationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of superoxide anion generationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylationEpidermal growth factor receptorHomo sapiens (human)
response to cobalaminEpidermal growth factor receptorHomo sapiens (human)
response to hydroxyisoflavoneEpidermal growth factor receptorHomo sapiens (human)
cellular response to reactive oxygen speciesEpidermal growth factor receptorHomo sapiens (human)
peptidyl-tyrosine autophosphorylationEpidermal growth factor receptorHomo sapiens (human)
ERBB2-EGFR signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
negative regulation of epidermal growth factor receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
negative regulation of protein catabolic processEpidermal growth factor receptorHomo sapiens (human)
vasodilationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of phosphorylationEpidermal growth factor receptorHomo sapiens (human)
ovulation cycleEpidermal growth factor receptorHomo sapiens (human)
hydrogen peroxide metabolic processEpidermal growth factor receptorHomo sapiens (human)
negative regulation of apoptotic processEpidermal growth factor receptorHomo sapiens (human)
positive regulation of MAP kinase activityEpidermal growth factor receptorHomo sapiens (human)
tongue developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cyclin-dependent protein serine/threonine kinase activityEpidermal growth factor receptorHomo sapiens (human)
positive regulation of DNA repairEpidermal growth factor receptorHomo sapiens (human)
positive regulation of DNA replicationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of bone resorptionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of DNA-templated transcriptionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of vasoconstrictionEpidermal growth factor receptorHomo sapiens (human)
negative regulation of mitotic cell cycleEpidermal growth factor receptorHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIEpidermal growth factor receptorHomo sapiens (human)
regulation of JNK cascadeEpidermal growth factor receptorHomo sapiens (human)
symbiont entry into host cellEpidermal growth factor receptorHomo sapiens (human)
protein autophosphorylationEpidermal growth factor receptorHomo sapiens (human)
astrocyte activationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of fibroblast proliferationEpidermal growth factor receptorHomo sapiens (human)
digestive tract morphogenesisEpidermal growth factor receptorHomo sapiens (human)
positive regulation of smooth muscle cell proliferationEpidermal growth factor receptorHomo sapiens (human)
neuron projection morphogenesisEpidermal growth factor receptorHomo sapiens (human)
epithelial cell proliferationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of epithelial cell proliferationEpidermal growth factor receptorHomo sapiens (human)
regulation of peptidyl-tyrosine phosphorylationEpidermal growth factor receptorHomo sapiens (human)
protein insertion into membraneEpidermal growth factor receptorHomo sapiens (human)
response to calcium ionEpidermal growth factor receptorHomo sapiens (human)
regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of synaptic transmission, glutamatergicEpidermal growth factor receptorHomo sapiens (human)
positive regulation of glial cell proliferationEpidermal growth factor receptorHomo sapiens (human)
morphogenesis of an epithelial foldEpidermal growth factor receptorHomo sapiens (human)
eyelid development in camera-type eyeEpidermal growth factor receptorHomo sapiens (human)
response to UV-AEpidermal growth factor receptorHomo sapiens (human)
positive regulation of mucus secretionEpidermal growth factor receptorHomo sapiens (human)
regulation of ERK1 and ERK2 cascadeEpidermal growth factor receptorHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeEpidermal growth factor receptorHomo sapiens (human)
cellular response to amino acid stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to mechanical stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to cadmium ionEpidermal growth factor receptorHomo sapiens (human)
cellular response to epidermal growth factor stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to estradiol stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to xenobiotic stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to dexamethasone stimulusEpidermal growth factor receptorHomo sapiens (human)
positive regulation of canonical Wnt signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
liver regenerationEpidermal growth factor receptorHomo sapiens (human)
cell-cell adhesionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of protein kinase C activityEpidermal growth factor receptorHomo sapiens (human)
positive regulation of G1/S transition of mitotic cell cycleEpidermal growth factor receptorHomo sapiens (human)
positive regulation of non-canonical NF-kappaB signal transductionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of prolactin secretionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of miRNA transcriptionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of protein localization to plasma membraneEpidermal growth factor receptorHomo sapiens (human)
negative regulation of cardiocyte differentiationEpidermal growth factor receptorHomo sapiens (human)
neurogenesisEpidermal growth factor receptorHomo sapiens (human)
multicellular organism developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of kinase activityEpidermal growth factor receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
cell surface receptor signaling pathway via JAK-STATInterferon betaHomo sapiens (human)
response to exogenous dsRNAInterferon betaHomo sapiens (human)
B cell activation involved in immune responseInterferon betaHomo sapiens (human)
cell surface receptor signaling pathwayInterferon betaHomo sapiens (human)
cell surface receptor signaling pathway via JAK-STATInterferon betaHomo sapiens (human)
response to virusInterferon betaHomo sapiens (human)
positive regulation of autophagyInterferon betaHomo sapiens (human)
cytokine-mediated signaling pathwayInterferon betaHomo sapiens (human)
natural killer cell activationInterferon betaHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylation of STAT proteinInterferon betaHomo sapiens (human)
cellular response to interferon-betaInterferon betaHomo sapiens (human)
B cell proliferationInterferon betaHomo sapiens (human)
negative regulation of viral genome replicationInterferon betaHomo sapiens (human)
innate immune responseInterferon betaHomo sapiens (human)
positive regulation of innate immune responseInterferon betaHomo sapiens (human)
regulation of MHC class I biosynthetic processInterferon betaHomo sapiens (human)
negative regulation of T cell differentiationInterferon betaHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIInterferon betaHomo sapiens (human)
defense response to virusInterferon betaHomo sapiens (human)
type I interferon-mediated signaling pathwayInterferon betaHomo sapiens (human)
neuron cellular homeostasisInterferon betaHomo sapiens (human)
cellular response to exogenous dsRNAInterferon betaHomo sapiens (human)
cellular response to virusInterferon betaHomo sapiens (human)
negative regulation of Lewy body formationInterferon betaHomo sapiens (human)
negative regulation of T-helper 2 cell cytokine productionInterferon betaHomo sapiens (human)
positive regulation of apoptotic signaling pathwayInterferon betaHomo sapiens (human)
response to exogenous dsRNAInterferon betaHomo sapiens (human)
B cell differentiationInterferon betaHomo sapiens (human)
natural killer cell activation involved in immune responseInterferon betaHomo sapiens (human)
adaptive immune responseInterferon betaHomo sapiens (human)
T cell activation involved in immune responseInterferon betaHomo sapiens (human)
humoral immune responseInterferon betaHomo sapiens (human)
cellular response to amyloid-betaHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of protein phosphorylationHigh affinity nerve growth factor receptorHomo sapiens (human)
protein phosphorylationHigh affinity nerve growth factor receptorHomo sapiens (human)
axon guidanceHigh affinity nerve growth factor receptorHomo sapiens (human)
learning or memoryHigh affinity nerve growth factor receptorHomo sapiens (human)
circadian rhythmHigh affinity nerve growth factor receptorHomo sapiens (human)
negative regulation of cell population proliferationHigh affinity nerve growth factor receptorHomo sapiens (human)
response to xenobiotic stimulusHigh affinity nerve growth factor receptorHomo sapiens (human)
programmed cell death involved in cell developmentHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of neuron projection developmentHigh affinity nerve growth factor receptorHomo sapiens (human)
peptidyl-tyrosine phosphorylationHigh affinity nerve growth factor receptorHomo sapiens (human)
olfactory nerve developmentHigh affinity nerve growth factor receptorHomo sapiens (human)
B cell differentiationHigh affinity nerve growth factor receptorHomo sapiens (human)
response to nutrient levelsHigh affinity nerve growth factor receptorHomo sapiens (human)
peptidyl-tyrosine autophosphorylationHigh affinity nerve growth factor receptorHomo sapiens (human)
nerve growth factor signaling pathwayHigh affinity nerve growth factor receptorHomo sapiens (human)
mechanoreceptor differentiationHigh affinity nerve growth factor receptorHomo sapiens (human)
negative regulation of apoptotic processHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of programmed cell deathHigh affinity nerve growth factor receptorHomo sapiens (human)
negative regulation of neuron apoptotic processHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of GTPase activityHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of Ras protein signal transductionHigh affinity nerve growth factor receptorHomo sapiens (human)
protein autophosphorylationHigh affinity nerve growth factor receptorHomo sapiens (human)
neurotrophin TRK receptor signaling pathwayHigh affinity nerve growth factor receptorHomo sapiens (human)
ephrin receptor signaling pathwayHigh affinity nerve growth factor receptorHomo sapiens (human)
sympathetic nervous system developmentHigh affinity nerve growth factor receptorHomo sapiens (human)
response to axon injuryHigh affinity nerve growth factor receptorHomo sapiens (human)
detection of temperature stimulus involved in sensory perception of painHigh affinity nerve growth factor receptorHomo sapiens (human)
detection of mechanical stimulus involved in sensory perception of painHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of NF-kappaB transcription factor activityHigh affinity nerve growth factor receptorHomo sapiens (human)
neuron apoptotic processHigh affinity nerve growth factor receptorHomo sapiens (human)
response to hydrostatic pressureHigh affinity nerve growth factor receptorHomo sapiens (human)
response to electrical stimulusHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of synapse assemblyHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of synaptic transmission, glutamatergicHigh affinity nerve growth factor receptorHomo sapiens (human)
Sertoli cell developmentHigh affinity nerve growth factor receptorHomo sapiens (human)
axonogenesis involved in innervationHigh affinity nerve growth factor receptorHomo sapiens (human)
behavioral response to formalin induced painHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeHigh affinity nerve growth factor receptorHomo sapiens (human)
cellular response to nicotineHigh affinity nerve growth factor receptorHomo sapiens (human)
cellular response to nerve growth factor stimulusHigh affinity nerve growth factor receptorHomo sapiens (human)
multicellular organism developmentHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of kinase activityHigh affinity nerve growth factor receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeHigh affinity nerve growth factor receptorHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionHigh affinity nerve growth factor receptorHomo sapiens (human)
chromosome segregationADP/ATP translocase 2Homo sapiens (human)
positive regulation of cell population proliferationADP/ATP translocase 2Homo sapiens (human)
adenine transportADP/ATP translocase 2Homo sapiens (human)
B cell differentiationADP/ATP translocase 2Homo sapiens (human)
erythrocyte differentiationADP/ATP translocase 2Homo sapiens (human)
regulation of mitochondrial membrane permeabilityADP/ATP translocase 2Homo sapiens (human)
adenine nucleotide transportADP/ATP translocase 2Homo sapiens (human)
mitochondrial ADP transmembrane transportADP/ATP translocase 2Homo sapiens (human)
negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathwayADP/ATP translocase 2Homo sapiens (human)
positive regulation of mitophagyADP/ATP translocase 2Homo sapiens (human)
proton transmembrane transportADP/ATP translocase 2Homo sapiens (human)
mitochondrial ATP transmembrane transportADP/ATP translocase 2Homo sapiens (human)
cellular response to leukemia inhibitory factorADP/ATP translocase 2Homo sapiens (human)
adaptive thermogenesisADP/ATP translocase 2Homo sapiens (human)
steroid catabolic processCytochrome P450 1A2Homo sapiens (human)
porphyrin-containing compound metabolic processCytochrome P450 1A2Homo sapiens (human)
xenobiotic metabolic processCytochrome P450 1A2Homo sapiens (human)
cholesterol metabolic processCytochrome P450 1A2Homo sapiens (human)
estrogen metabolic processCytochrome P450 1A2Homo sapiens (human)
toxin biosynthetic processCytochrome P450 1A2Homo sapiens (human)
post-embryonic developmentCytochrome P450 1A2Homo sapiens (human)
alkaloid metabolic processCytochrome P450 1A2Homo sapiens (human)
regulation of gene expressionCytochrome P450 1A2Homo sapiens (human)
monoterpenoid metabolic processCytochrome P450 1A2Homo sapiens (human)
dibenzo-p-dioxin metabolic processCytochrome P450 1A2Homo sapiens (human)
epoxygenase P450 pathwayCytochrome P450 1A2Homo sapiens (human)
lung developmentCytochrome P450 1A2Homo sapiens (human)
methylationCytochrome P450 1A2Homo sapiens (human)
monocarboxylic acid metabolic processCytochrome P450 1A2Homo sapiens (human)
xenobiotic catabolic processCytochrome P450 1A2Homo sapiens (human)
retinol metabolic processCytochrome P450 1A2Homo sapiens (human)
long-chain fatty acid biosynthetic processCytochrome P450 1A2Homo sapiens (human)
cellular respirationCytochrome P450 1A2Homo sapiens (human)
aflatoxin metabolic processCytochrome P450 1A2Homo sapiens (human)
hydrogen peroxide biosynthetic processCytochrome P450 1A2Homo sapiens (human)
oxidative demethylationCytochrome P450 1A2Homo sapiens (human)
cellular response to cadmium ionCytochrome P450 1A2Homo sapiens (human)
omega-hydroxylase P450 pathwayCytochrome P450 1A2Homo sapiens (human)
long-chain fatty acid metabolic processCytochrome P450 2E1Homo sapiens (human)
lipid hydroxylationCytochrome P450 2E1Homo sapiens (human)
xenobiotic metabolic processCytochrome P450 2E1Homo sapiens (human)
steroid metabolic processCytochrome P450 2E1Homo sapiens (human)
response to bacteriumCytochrome P450 2E1Homo sapiens (human)
monoterpenoid metabolic processCytochrome P450 2E1Homo sapiens (human)
carbon tetrachloride metabolic processCytochrome P450 2E1Homo sapiens (human)
benzene metabolic processCytochrome P450 2E1Homo sapiens (human)
4-nitrophenol metabolic processCytochrome P450 2E1Homo sapiens (human)
halogenated hydrocarbon metabolic processCytochrome P450 2E1Homo sapiens (human)
long-chain fatty acid biosynthetic processCytochrome P450 2E1Homo sapiens (human)
epoxygenase P450 pathwayCytochrome P450 2E1Homo sapiens (human)
adaptive immune responseProtein kinase C beta typeHomo sapiens (human)
chromatin remodelingProtein kinase C beta typeHomo sapiens (human)
regulation of transcription by RNA polymerase IIProtein kinase C beta typeHomo sapiens (human)
protein phosphorylationProtein kinase C beta typeHomo sapiens (human)
calcium ion transportProtein kinase C beta typeHomo sapiens (human)
intracellular calcium ion homeostasisProtein kinase C beta typeHomo sapiens (human)
apoptotic processProtein kinase C beta typeHomo sapiens (human)
mitotic nuclear membrane disassemblyProtein kinase C beta typeHomo sapiens (human)
signal transductionProtein kinase C beta typeHomo sapiens (human)
phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathwayProtein kinase C beta typeHomo sapiens (human)
response to xenobiotic stimulusProtein kinase C beta typeHomo sapiens (human)
response to glucoseProtein kinase C beta typeHomo sapiens (human)
regulation of glucose transmembrane transportProtein kinase C beta typeHomo sapiens (human)
negative regulation of glucose transmembrane transportProtein kinase C beta typeHomo sapiens (human)
regulation of dopamine secretionProtein kinase C beta typeHomo sapiens (human)
dibenzo-p-dioxin metabolic processProtein kinase C beta typeHomo sapiens (human)
positive regulation of vascular endothelial growth factor receptor signaling pathwayProtein kinase C beta typeHomo sapiens (human)
positive regulation of insulin secretionProtein kinase C beta typeHomo sapiens (human)
response to vitamin DProtein kinase C beta typeHomo sapiens (human)
regulation of growthProtein kinase C beta typeHomo sapiens (human)
B cell activationProtein kinase C beta typeHomo sapiens (human)
positive regulation of odontogenesis of dentin-containing toothProtein kinase C beta typeHomo sapiens (human)
lipoprotein transportProtein kinase C beta typeHomo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionProtein kinase C beta typeHomo sapiens (human)
post-translational protein modificationProtein kinase C beta typeHomo sapiens (human)
response to ethanolProtein kinase C beta typeHomo sapiens (human)
positive regulation of angiogenesisProtein kinase C beta typeHomo sapiens (human)
positive regulation of DNA-templated transcriptionProtein kinase C beta typeHomo sapiens (human)
negative regulation of insulin receptor signaling pathwayProtein kinase C beta typeHomo sapiens (human)
B cell receptor signaling pathwayProtein kinase C beta typeHomo sapiens (human)
positive regulation of B cell receptor signaling pathwayProtein kinase C beta typeHomo sapiens (human)
cellular response to carbohydrate stimulusProtein kinase C beta typeHomo sapiens (human)
presynaptic modulation of chemical synaptic transmissionProtein kinase C beta typeHomo sapiens (human)
regulation of synaptic vesicle exocytosisProtein kinase C beta typeHomo sapiens (human)
peptidyl-serine phosphorylationProtein kinase C beta typeHomo sapiens (human)
intracellular signal transductionProtein kinase C beta typeHomo sapiens (human)
positive regulation of MAP kinase activityInsulin receptorHomo sapiens (human)
positive regulation of protein phosphorylationInsulin receptorHomo sapiens (human)
positive regulation of receptor internalizationInsulin receptorHomo sapiens (human)
heart morphogenesisInsulin receptorHomo sapiens (human)
regulation of DNA-templated transcriptionInsulin receptorHomo sapiens (human)
protein phosphorylationInsulin receptorHomo sapiens (human)
receptor-mediated endocytosisInsulin receptorHomo sapiens (human)
G protein-coupled receptor signaling pathwayInsulin receptorHomo sapiens (human)
learningInsulin receptorHomo sapiens (human)
memoryInsulin receptorHomo sapiens (human)
positive regulation of cell population proliferationInsulin receptorHomo sapiens (human)
insulin receptor signaling pathwayInsulin receptorHomo sapiens (human)
epidermis developmentInsulin receptorHomo sapiens (human)
male gonad developmentInsulin receptorHomo sapiens (human)
peptidyl-tyrosine phosphorylationInsulin receptorHomo sapiens (human)
male sex determinationInsulin receptorHomo sapiens (human)
adrenal gland developmentInsulin receptorHomo sapiens (human)
positive regulation of cell migrationInsulin receptorHomo sapiens (human)
exocrine pancreas developmentInsulin receptorHomo sapiens (human)
receptor internalizationInsulin receptorHomo sapiens (human)
activation of protein kinase activityInsulin receptorHomo sapiens (human)
activation of protein kinase B activityInsulin receptorHomo sapiens (human)
cellular response to insulin stimulusInsulin receptorHomo sapiens (human)
glucose homeostasisInsulin receptorHomo sapiens (human)
positive regulation of protein-containing complex disassemblyInsulin receptorHomo sapiens (human)
positive regulation of MAPK cascadeInsulin receptorHomo sapiens (human)
positive regulation of nitric oxide biosynthetic processInsulin receptorHomo sapiens (human)
positive regulation of glycogen biosynthetic processInsulin receptorHomo sapiens (human)
positive regulation of glycolytic processInsulin receptorHomo sapiens (human)
positive regulation of mitotic nuclear divisionInsulin receptorHomo sapiens (human)
positive regulation of DNA-templated transcriptionInsulin receptorHomo sapiens (human)
regulation of embryonic developmentInsulin receptorHomo sapiens (human)
positive regulation of glucose importInsulin receptorHomo sapiens (human)
symbiont entry into host cellInsulin receptorHomo sapiens (human)
protein autophosphorylationInsulin receptorHomo sapiens (human)
positive regulation of developmental growthInsulin receptorHomo sapiens (human)
positive regulation of meiotic cell cycleInsulin receptorHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionInsulin receptorHomo sapiens (human)
positive regulation of respiratory burstInsulin receptorHomo sapiens (human)
cellular response to growth factor stimulusInsulin receptorHomo sapiens (human)
dendritic spine maintenanceInsulin receptorHomo sapiens (human)
amyloid-beta clearanceInsulin receptorHomo sapiens (human)
transport across blood-brain barrierInsulin receptorHomo sapiens (human)
neuron projection maintenanceInsulin receptorHomo sapiens (human)
regulation of female gonad developmentInsulin receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayInsulin receptorHomo sapiens (human)
multicellular organism developmentInsulin receptorHomo sapiens (human)
positive regulation of kinase activityInsulin receptorHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase LckHomo sapiens (human)
intracellular zinc ion homeostasisTyrosine-protein kinase LckHomo sapiens (human)
activation of cysteine-type endopeptidase activity involved in apoptotic processTyrosine-protein kinase LckHomo sapiens (human)
response to xenobiotic stimulusTyrosine-protein kinase LckHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase LckHomo sapiens (human)
hemopoiesisTyrosine-protein kinase LckHomo sapiens (human)
platelet activationTyrosine-protein kinase LckHomo sapiens (human)
T cell differentiationTyrosine-protein kinase LckHomo sapiens (human)
T cell costimulationTyrosine-protein kinase LckHomo sapiens (human)
positive regulation of heterotypic cell-cell adhesionTyrosine-protein kinase LckHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase LckHomo sapiens (human)
peptidyl-tyrosine autophosphorylationTyrosine-protein kinase LckHomo sapiens (human)
Fc-gamma receptor signaling pathwayTyrosine-protein kinase LckHomo sapiens (human)
T cell receptor signaling pathwayTyrosine-protein kinase LckHomo sapiens (human)
positive regulation of T cell receptor signaling pathwayTyrosine-protein kinase LckHomo sapiens (human)
positive regulation of T cell activationTyrosine-protein kinase LckHomo sapiens (human)
leukocyte migrationTyrosine-protein kinase LckHomo sapiens (human)
release of sequestered calcium ion into cytosolTyrosine-protein kinase LckHomo sapiens (human)
regulation of lymphocyte activationTyrosine-protein kinase LckHomo sapiens (human)
positive regulation of leukocyte cell-cell adhesionTyrosine-protein kinase LckHomo sapiens (human)
positive regulation of intrinsic apoptotic signaling pathwayTyrosine-protein kinase LckHomo sapiens (human)
innate immune responseTyrosine-protein kinase LckHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase LckHomo sapiens (human)
B cell receptor signaling pathwayTyrosine-protein kinase LckHomo sapiens (human)
response to singlet oxygenTyrosine-protein kinase FynHomo sapiens (human)
neuron migrationTyrosine-protein kinase FynHomo sapiens (human)
stimulatory C-type lectin receptor signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
adaptive immune responseTyrosine-protein kinase FynHomo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusTyrosine-protein kinase FynHomo sapiens (human)
heart processTyrosine-protein kinase FynHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase FynHomo sapiens (human)
calcium ion transportTyrosine-protein kinase FynHomo sapiens (human)
G protein-coupled glutamate receptor signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
axon guidanceTyrosine-protein kinase FynHomo sapiens (human)
learningTyrosine-protein kinase FynHomo sapiens (human)
feeding behaviorTyrosine-protein kinase FynHomo sapiens (human)
regulation of cell shapeTyrosine-protein kinase FynHomo sapiens (human)
gene expressionTyrosine-protein kinase FynHomo sapiens (human)
negative regulation of gene expressionTyrosine-protein kinase FynHomo sapiens (human)
negative regulation of hydrogen peroxide biosynthetic processTyrosine-protein kinase FynHomo sapiens (human)
positive regulation of neuron projection developmentTyrosine-protein kinase FynHomo sapiens (human)
protein ubiquitinationTyrosine-protein kinase FynHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase FynHomo sapiens (human)
protein catabolic processTyrosine-protein kinase FynHomo sapiens (human)
forebrain developmentTyrosine-protein kinase FynHomo sapiens (human)
T cell costimulationTyrosine-protein kinase FynHomo sapiens (human)
negative regulation of protein ubiquitinationTyrosine-protein kinase FynHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase FynHomo sapiens (human)
cellular response to platelet-derived growth factor stimulusTyrosine-protein kinase FynHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisTyrosine-protein kinase FynHomo sapiens (human)
negative regulation of protein catabolic processTyrosine-protein kinase FynHomo sapiens (human)
positive regulation of tyrosine phosphorylation of STAT proteinTyrosine-protein kinase FynHomo sapiens (human)
response to ethanolTyrosine-protein kinase FynHomo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
ephrin receptor signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
dendrite morphogenesisTyrosine-protein kinase FynHomo sapiens (human)
regulation of peptidyl-tyrosine phosphorylationTyrosine-protein kinase FynHomo sapiens (human)
activated T cell proliferationTyrosine-protein kinase FynHomo sapiens (human)
modulation of chemical synaptic transmissionTyrosine-protein kinase FynHomo sapiens (human)
T cell receptor signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
leukocyte migrationTyrosine-protein kinase FynHomo sapiens (human)
detection of mechanical stimulus involved in sensory perception of painTyrosine-protein kinase FynHomo sapiens (human)
cellular response to hydrogen peroxideTyrosine-protein kinase FynHomo sapiens (human)
cellular response to transforming growth factor beta stimulusTyrosine-protein kinase FynHomo sapiens (human)
positive regulation of protein targeting to membraneTyrosine-protein kinase FynHomo sapiens (human)
dendritic spine maintenanceTyrosine-protein kinase FynHomo sapiens (human)
positive regulation of protein localization to nucleusTyrosine-protein kinase FynHomo sapiens (human)
regulation of glutamate receptor signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
negative regulation of dendritic spine maintenanceTyrosine-protein kinase FynHomo sapiens (human)
response to amyloid-betaTyrosine-protein kinase FynHomo sapiens (human)
cellular response to amyloid-betaTyrosine-protein kinase FynHomo sapiens (human)
cellular response to L-glutamateTyrosine-protein kinase FynHomo sapiens (human)
cellular response to glycineTyrosine-protein kinase FynHomo sapiens (human)
positive regulation of protein localization to membraneTyrosine-protein kinase FynHomo sapiens (human)
regulation of calcium ion import across plasma membraneTyrosine-protein kinase FynHomo sapiens (human)
positive regulation of cysteine-type endopeptidase activityTyrosine-protein kinase FynHomo sapiens (human)
innate immune responseTyrosine-protein kinase FynHomo sapiens (human)
cell differentiationTyrosine-protein kinase FynHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase FynHomo sapiens (human)
G1/S transition of mitotic cell cycleCyclin-dependent kinase 1Homo sapiens (human)
G2/M transition of mitotic cell cycleCyclin-dependent kinase 1Homo sapiens (human)
microtubule cytoskeleton organizationCyclin-dependent kinase 1Homo sapiens (human)
DNA replicationCyclin-dependent kinase 1Homo sapiens (human)
DNA repairCyclin-dependent kinase 1Homo sapiens (human)
chromatin remodelingCyclin-dependent kinase 1Homo sapiens (human)
regulation of transcription by RNA polymerase IICyclin-dependent kinase 1Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 1Homo sapiens (human)
apoptotic processCyclin-dependent kinase 1Homo sapiens (human)
DNA damage responseCyclin-dependent kinase 1Homo sapiens (human)
mitotic nuclear membrane disassemblyCyclin-dependent kinase 1Homo sapiens (human)
centrosome cycleCyclin-dependent kinase 1Homo sapiens (human)
pronuclear fusionCyclin-dependent kinase 1Homo sapiens (human)
response to xenobiotic stimulusCyclin-dependent kinase 1Homo sapiens (human)
response to toxic substanceCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of gene expressionCyclin-dependent kinase 1Homo sapiens (human)
negative regulation of gene expressionCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of G2/M transition of mitotic cell cycleCyclin-dependent kinase 1Homo sapiens (human)
regulation of Schwann cell differentiationCyclin-dependent kinase 1Homo sapiens (human)
response to amineCyclin-dependent kinase 1Homo sapiens (human)
response to activityCyclin-dependent kinase 1Homo sapiens (human)
cell migrationCyclin-dependent kinase 1Homo sapiens (human)
peptidyl-serine phosphorylationCyclin-dependent kinase 1Homo sapiens (human)
peptidyl-threonine phosphorylationCyclin-dependent kinase 1Homo sapiens (human)
chromosome condensationCyclin-dependent kinase 1Homo sapiens (human)
epithelial cell differentiationCyclin-dependent kinase 1Homo sapiens (human)
animal organ regenerationCyclin-dependent kinase 1Homo sapiens (human)
protein localization to kinetochoreCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of protein import into nucleusCyclin-dependent kinase 1Homo sapiens (human)
regulation of circadian rhythmCyclin-dependent kinase 1Homo sapiens (human)
negative regulation of apoptotic processCyclin-dependent kinase 1Homo sapiens (human)
response to ethanolCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of DNA replicationCyclin-dependent kinase 1Homo sapiens (human)
regulation of embryonic developmentCyclin-dependent kinase 1Homo sapiens (human)
response to cadmium ionCyclin-dependent kinase 1Homo sapiens (human)
response to copper ionCyclin-dependent kinase 1Homo sapiens (human)
symbiont entry into host cellCyclin-dependent kinase 1Homo sapiens (human)
fibroblast proliferationCyclin-dependent kinase 1Homo sapiens (human)
rhythmic processCyclin-dependent kinase 1Homo sapiens (human)
response to axon injuryCyclin-dependent kinase 1Homo sapiens (human)
cell divisionCyclin-dependent kinase 1Homo sapiens (human)
ventricular cardiac muscle cell developmentCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of cardiac muscle cell proliferationCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of mitotic sister chromatid segregationCyclin-dependent kinase 1Homo sapiens (human)
protein-containing complex assemblyCyclin-dependent kinase 1Homo sapiens (human)
cellular response to hydrogen peroxideCyclin-dependent kinase 1Homo sapiens (human)
ERK1 and ERK2 cascadeCyclin-dependent kinase 1Homo sapiens (human)
cellular response to organic cyclic compoundCyclin-dependent kinase 1Homo sapiens (human)
Golgi disassemblyCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of protein localization to nucleusCyclin-dependent kinase 1Homo sapiens (human)
regulation of attachment of mitotic spindle microtubules to kinetochoreCyclin-dependent kinase 1Homo sapiens (human)
microtubule cytoskeleton organization involved in mitosisCyclin-dependent kinase 1Homo sapiens (human)
positive regulation of mitochondrial ATP synthesis coupled electron transportCyclin-dependent kinase 1Homo sapiens (human)
mitotic G2 DNA damage checkpoint signalingCyclin-dependent kinase 1Homo sapiens (human)
protein deubiquitinationCyclin-dependent kinase 1Homo sapiens (human)
glycogen metabolic processGlycogen phosphorylase, liver formHomo sapiens (human)
5-phosphoribose 1-diphosphate biosynthetic processGlycogen phosphorylase, liver formHomo sapiens (human)
response to bacteriumGlycogen phosphorylase, liver formHomo sapiens (human)
glucose homeostasisGlycogen phosphorylase, liver formHomo sapiens (human)
necroptotic processGlycogen phosphorylase, liver formHomo sapiens (human)
glycogen catabolic processGlycogen phosphorylase, liver formHomo sapiens (human)
microtubule bundle formationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
centrosome cycleTyrosine-protein kinase Fes/FpsHomo sapiens (human)
regulation of cell shapeTyrosine-protein kinase Fes/FpsHomo sapiens (human)
positive regulation of neuron projection developmentTyrosine-protein kinase Fes/FpsHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
regulation of cell adhesionTyrosine-protein kinase Fes/FpsHomo sapiens (human)
positive regulation of microtubule polymerizationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
regulation of cell population proliferationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
regulation of mast cell degranulationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
regulation of cell differentiationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
positive regulation of myeloid cell differentiationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
positive regulation of monocyte differentiationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
protein autophosphorylationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
myoblast proliferationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
cardiac muscle cell proliferationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
regulation of vesicle-mediated transportTyrosine-protein kinase Fes/FpsHomo sapiens (human)
cellular response to vitamin DTyrosine-protein kinase Fes/FpsHomo sapiens (human)
regulation of cell motilityTyrosine-protein kinase Fes/FpsHomo sapiens (human)
chemotaxisTyrosine-protein kinase Fes/FpsHomo sapiens (human)
cell adhesionTyrosine-protein kinase Fes/FpsHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase Fes/FpsHomo sapiens (human)
positive regulation of macrophage chemotaxisMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of macrophage proliferationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of protein phosphorylationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
response to ischemiaMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
inflammatory responseMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
signal transductionMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
axon guidanceMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cell population proliferationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of cell population proliferationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
negative regulation of cell population proliferationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
regulation of cell shapeMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
peptidyl-tyrosine phosphorylationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cytokine-mediated signaling pathwayMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
olfactory bulb developmentMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
forebrain neuron differentiationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
hemopoiesisMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
monocyte differentiationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
macrophage differentiationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
osteoclast differentiationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
ruffle organizationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of chemokine productionMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
regulation of actin cytoskeleton organizationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cellular response to macrophage colony-stimulating factor stimulusMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
macrophage colony-stimulating factor signaling pathwayMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of tyrosine phosphorylation of STAT proteinMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
negative regulation of apoptotic processMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation by host of viral processMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
innate immune responseMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
regulation of bone resorptionMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cell-cell junction maintenanceMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
protein autophosphorylationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
mammary gland duct morphogenesisMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of protein tyrosine kinase activityMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
microglial cell proliferationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cellular response to cytokine stimulusMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
regulation of macrophage migrationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of cell motilityMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of cell migrationMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
regulation of MAPK cascadeMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
positive regulation of kinase activityMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
multicellular organism developmentMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
purine ribonucleoside salvageAdenine phosphoribosyltransferaseHomo sapiens (human)
grooming behaviorAdenine phosphoribosyltransferaseHomo sapiens (human)
GMP salvageAdenine phosphoribosyltransferaseHomo sapiens (human)
IMP salvageAdenine phosphoribosyltransferaseHomo sapiens (human)
AMP salvageAdenine phosphoribosyltransferaseHomo sapiens (human)
adenine salvageAdenine phosphoribosyltransferaseHomo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusTyrosine-protein kinase YesHomo sapiens (human)
regulation of glucose transmembrane transportTyrosine-protein kinase YesHomo sapiens (human)
T cell costimulationTyrosine-protein kinase YesHomo sapiens (human)
cellular response to platelet-derived growth factor stimulusTyrosine-protein kinase YesHomo sapiens (human)
protein modification processTyrosine-protein kinase YesHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisTyrosine-protein kinase YesHomo sapiens (human)
regulation of vascular permeabilityTyrosine-protein kinase YesHomo sapiens (human)
positive regulation of transcription by RNA polymerase IITyrosine-protein kinase YesHomo sapiens (human)
ephrin receptor signaling pathwayTyrosine-protein kinase YesHomo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationTyrosine-protein kinase YesHomo sapiens (human)
leukocyte migrationTyrosine-protein kinase YesHomo sapiens (human)
cellular response to retinoic acidTyrosine-protein kinase YesHomo sapiens (human)
cellular response to transforming growth factor beta stimulusTyrosine-protein kinase YesHomo sapiens (human)
innate immune responseTyrosine-protein kinase YesHomo sapiens (human)
cell differentiationTyrosine-protein kinase YesHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase YesHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase YesHomo sapiens (human)
DNA damage checkpoint signalingTyrosine-protein kinase LynHomo sapiens (human)
B cell homeostasisTyrosine-protein kinase LynHomo sapiens (human)
regulation of cytokine productionTyrosine-protein kinase LynHomo sapiens (human)
regulation of protein phosphorylationTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of protein phosphorylationTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of protein phosphorylationTyrosine-protein kinase LynHomo sapiens (human)
stimulatory C-type lectin receptor signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
hematopoietic progenitor cell differentiationTyrosine-protein kinase LynHomo sapiens (human)
adaptive immune responseTyrosine-protein kinase LynHomo sapiens (human)
Fc receptor mediated stimulatory signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
tolerance induction to self antigenTyrosine-protein kinase LynHomo sapiens (human)
histamine secretion by mast cellTyrosine-protein kinase LynHomo sapiens (human)
platelet degranulationTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of myeloid leukocyte differentiationTyrosine-protein kinase LynHomo sapiens (human)
immune response-regulating cell surface receptor signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
Fc receptor mediated inhibitory signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusTyrosine-protein kinase LynHomo sapiens (human)
regulation of B cell apoptotic processTyrosine-protein kinase LynHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase LynHomo sapiens (human)
DNA damage responseTyrosine-protein kinase LynHomo sapiens (human)
response to sterol depletionTyrosine-protein kinase LynHomo sapiens (human)
signal transductionTyrosine-protein kinase LynHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of cell population proliferationTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of cell population proliferationTyrosine-protein kinase LynHomo sapiens (human)
response to xenobiotic stimulusTyrosine-protein kinase LynHomo sapiens (human)
response to toxic substanceTyrosine-protein kinase LynHomo sapiens (human)
response to hormoneTyrosine-protein kinase LynHomo sapiens (human)
response to carbohydrateTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of neuron projection developmentTyrosine-protein kinase LynHomo sapiens (human)
oligodendrocyte developmentTyrosine-protein kinase LynHomo sapiens (human)
response to organic cyclic compoundTyrosine-protein kinase LynHomo sapiens (human)
fatty acid transportTyrosine-protein kinase LynHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase LynHomo sapiens (human)
erythrocyte differentiationTyrosine-protein kinase LynHomo sapiens (human)
eosinophil differentiationTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of cell migrationTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of B cell proliferationTyrosine-protein kinase LynHomo sapiens (human)
T cell costimulationTyrosine-protein kinase LynHomo sapiens (human)
lipopolysaccharide-mediated signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
response to insulinTyrosine-protein kinase LynHomo sapiens (human)
regulation of mast cell activationTyrosine-protein kinase LynHomo sapiens (human)
regulation of cell adhesion mediated by integrinTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of toll-like receptor 2 signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
toll-like receptor 4 signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of toll-like receptor 4 signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
cellular response to heatTyrosine-protein kinase LynHomo sapiens (human)
interleukin-5-mediated signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
Fc-epsilon receptor signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisTyrosine-protein kinase LynHomo sapiens (human)
C-X-C chemokine receptor CXCR4 signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of tyrosine phosphorylation of STAT proteinTyrosine-protein kinase LynHomo sapiens (human)
response to amino acidTyrosine-protein kinase LynHomo sapiens (human)
regulation of mast cell degranulationTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of MAP kinase activityTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of MAPK cascadeTyrosine-protein kinase LynHomo sapiens (human)
regulation of erythrocyte differentiationTyrosine-protein kinase LynHomo sapiens (human)
protein autophosphorylationTyrosine-protein kinase LynHomo sapiens (human)
ephrin receptor signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
response to axon injuryTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of immune responseTyrosine-protein kinase LynHomo sapiens (human)
B cell receptor signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
regulation of B cell receptor signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
leukocyte migrationTyrosine-protein kinase LynHomo sapiens (human)
regulation of release of sequestered calcium ion into cytosolTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of glial cell proliferationTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of Fc receptor mediated stimulatory signaling pathwayTyrosine-protein kinase LynHomo sapiens (human)
growth hormone receptor signaling pathway via JAK-STATTyrosine-protein kinase LynHomo sapiens (human)
regulation of ERK1 and ERK2 cascadeTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of ERK1 and ERK2 cascadeTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of oligodendrocyte progenitor proliferationTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of mast cell proliferationTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of mast cell proliferationTyrosine-protein kinase LynHomo sapiens (human)
cellular response to retinoic acidTyrosine-protein kinase LynHomo sapiens (human)
regulation of monocyte chemotaxisTyrosine-protein kinase LynHomo sapiens (human)
regulation of platelet aggregationTyrosine-protein kinase LynHomo sapiens (human)
dendritic cell differentiationTyrosine-protein kinase LynHomo sapiens (human)
negative regulation of intracellular signal transductionTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic processTyrosine-protein kinase LynHomo sapiens (human)
positive regulation of dendritic cell apoptotic processTyrosine-protein kinase LynHomo sapiens (human)
neuron projection developmentTyrosine-protein kinase LynHomo sapiens (human)
innate immune responseTyrosine-protein kinase LynHomo sapiens (human)
MAPK cascadeProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
ureteric bud developmentProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
neural crest cell migrationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
embryonic epithelial tube formationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
protein phosphorylationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
homophilic cell adhesion via plasma membrane adhesion moleculesProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
neuron cell-cell adhesionProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
signal transductionProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
axon guidanceProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
posterior midgut developmentProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
response to xenobiotic stimulusProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of gene expressionProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of neuron projection developmentProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of neuron maturationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
regulation of cell adhesionProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of cell migrationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylation of STAT proteinProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
membrane protein proteolysisProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of cell adhesion mediated by integrinProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
ureter maturationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
glial cell-derived neurotrophic factor receptor signaling pathwayProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
neuron maturationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of MAPK cascadeProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of cell sizeProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of DNA-templated transcriptionProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
response to painProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
enteric nervous system developmentProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
regulation of axonogenesisProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
retina development in camera-type eyeProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
innervationProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
Peyer's patch morphogenesisProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
cellular response to retinoic acidProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of metanephric glomerulus developmentProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
lymphocyte migration into lymphoid organsProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
GDF15-GFRAL signaling pathwayProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of extrinsic apoptotic signaling pathway in absence of ligandProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
positive regulation of kinase activityProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
multicellular organism developmentProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
peptidyl-tyrosine autophosphorylationInsulin-like growth factor 1 receptorHomo sapiens (human)
cardiac atrium developmentInsulin-like growth factor 1 receptorHomo sapiens (human)
immune responseInsulin-like growth factor 1 receptorHomo sapiens (human)
signal transductionInsulin-like growth factor 1 receptorHomo sapiens (human)
axonogenesisInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of cell population proliferationInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin receptor signaling pathwayInsulin-like growth factor 1 receptorHomo sapiens (human)
negative regulation of muscle cell apoptotic processInsulin-like growth factor 1 receptorHomo sapiens (human)
cerebellum developmentInsulin-like growth factor 1 receptorHomo sapiens (human)
hippocampus developmentInsulin-like growth factor 1 receptorHomo sapiens (human)
establishment of cell polarityInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of cell migrationInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of cytokinesisInsulin-like growth factor 1 receptorHomo sapiens (human)
response to vitamin EInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of osteoblast proliferationInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to zinc ion starvationInsulin-like growth factor 1 receptorHomo sapiens (human)
response to nicotineInsulin-like growth factor 1 receptorHomo sapiens (human)
negative regulation of apoptotic processInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of protein-containing complex disassemblyInsulin-like growth factor 1 receptorHomo sapiens (human)
response to alkaloidInsulin-like growth factor 1 receptorHomo sapiens (human)
negative regulation of MAPK cascadeInsulin-like growth factor 1 receptorHomo sapiens (human)
phosphatidylinositol 3-kinase/protein kinase B signal transductionInsulin-like growth factor 1 receptorHomo sapiens (human)
estrous cycleInsulin-like growth factor 1 receptorHomo sapiens (human)
transcytosisInsulin-like growth factor 1 receptorHomo sapiens (human)
response to ethanolInsulin-like growth factor 1 receptorHomo sapiens (human)
regulation of JNK cascadeInsulin-like growth factor 1 receptorHomo sapiens (human)
protein autophosphorylationInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin-like growth factor receptor signaling pathwayInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of smooth muscle cell proliferationInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of axon regenerationInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of DNA metabolic processInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to mechanical stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to estradiol stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to progesterone stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to testosterone stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to dexamethasone stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to transforming growth factor beta stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of steroid hormone biosynthetic processInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular senescenceInsulin-like growth factor 1 receptorHomo sapiens (human)
dendritic spine maintenanceInsulin-like growth factor 1 receptorHomo sapiens (human)
amyloid-beta clearanceInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of cold-induced thermogenesisInsulin-like growth factor 1 receptorHomo sapiens (human)
response to L-glutamateInsulin-like growth factor 1 receptorHomo sapiens (human)
negative regulation of hepatocyte apoptotic processInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to aldosteroneInsulin-like growth factor 1 receptorHomo sapiens (human)
negative regulation of cholangiocyte apoptotic processInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to angiotensinInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to amyloid-betaInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to insulin-like growth factor stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
multicellular organism developmentInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of kinase activityInsulin-like growth factor 1 receptorHomo sapiens (human)
cellular response to glucose stimulusInsulin-like growth factor 1 receptorHomo sapiens (human)
positive regulation of MAPK cascadeInsulin-like growth factor 1 receptorHomo sapiens (human)
cotranslational protein targeting to membraneSignal recognition particle receptor subunit alphaHomo sapiens (human)
SRP-dependent cotranslational protein targeting to membrane, signal sequence recognitionSignal recognition particle receptor subunit alphaHomo sapiens (human)
intracellular protein transportSignal recognition particle receptor subunit alphaHomo sapiens (human)
protein targeting to ERSignal recognition particle receptor subunit alphaHomo sapiens (human)
mitochondrial electron transport, ubiquinol to cytochrome cCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
response to glucagonCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
cellular respirationCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
proton transmembrane transportCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
endothelial cell morphogenesisHepatocyte growth factor receptorHomo sapiens (human)
signal transductionHepatocyte growth factor receptorHomo sapiens (human)
cell surface receptor signaling pathwayHepatocyte growth factor receptorHomo sapiens (human)
negative regulation of autophagyHepatocyte growth factor receptorHomo sapiens (human)
positive regulation of microtubule polymerizationHepatocyte growth factor receptorHomo sapiens (human)
negative regulation of Rho protein signal transductionHepatocyte growth factor receptorHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIHepatocyte growth factor receptorHomo sapiens (human)
hepatocyte growth factor receptor signaling pathwayHepatocyte growth factor receptorHomo sapiens (human)
branching morphogenesis of an epithelial tubeHepatocyte growth factor receptorHomo sapiens (human)
positive chemotaxisHepatocyte growth factor receptorHomo sapiens (human)
negative regulation of stress fiber assemblyHepatocyte growth factor receptorHomo sapiens (human)
excitatory postsynaptic potentialHepatocyte growth factor receptorHomo sapiens (human)
establishment of skin barrierHepatocyte growth factor receptorHomo sapiens (human)
negative regulation of thrombin-activated receptor signaling pathwayHepatocyte growth factor receptorHomo sapiens (human)
semaphorin-plexin signaling pathwayHepatocyte growth factor receptorHomo sapiens (human)
negative regulation of hydrogen peroxide-mediated programmed cell deathHepatocyte growth factor receptorHomo sapiens (human)
negative regulation of guanyl-nucleotide exchange factor activityHepatocyte growth factor receptorHomo sapiens (human)
positive regulation of endothelial cell chemotaxisHepatocyte growth factor receptorHomo sapiens (human)
liver developmentHepatocyte growth factor receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayHepatocyte growth factor receptorHomo sapiens (human)
phagocytosisHepatocyte growth factor receptorHomo sapiens (human)
multicellular organism developmentHepatocyte growth factor receptorHomo sapiens (human)
neuron differentiationHepatocyte growth factor receptorHomo sapiens (human)
positive regulation of kinase activityHepatocyte growth factor receptorHomo sapiens (human)
cell migrationHepatocyte growth factor receptorHomo sapiens (human)
pancreas developmentHepatocyte growth factor receptorHomo sapiens (human)
nervous system developmentHepatocyte growth factor receptorHomo sapiens (human)
leukocyte migration involved in immune responseTyrosine-protein kinase HCKHomo sapiens (human)
innate immune response-activating signaling pathwayTyrosine-protein kinase HCKHomo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusTyrosine-protein kinase HCKHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase HCKHomo sapiens (human)
inflammatory responseTyrosine-protein kinase HCKHomo sapiens (human)
cell adhesionTyrosine-protein kinase HCKHomo sapiens (human)
integrin-mediated signaling pathwayTyrosine-protein kinase HCKHomo sapiens (human)
mesoderm developmentTyrosine-protein kinase HCKHomo sapiens (human)
positive regulation of cell population proliferationTyrosine-protein kinase HCKHomo sapiens (human)
regulation of cell shapeTyrosine-protein kinase HCKHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase HCKHomo sapiens (human)
cytokine-mediated signaling pathwayTyrosine-protein kinase HCKHomo sapiens (human)
positive regulation of actin filament polymerizationTyrosine-protein kinase HCKHomo sapiens (human)
lipopolysaccharide-mediated signaling pathwayTyrosine-protein kinase HCKHomo sapiens (human)
regulation of actin cytoskeleton organizationTyrosine-protein kinase HCKHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase HCKHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisTyrosine-protein kinase HCKHomo sapiens (human)
negative regulation of apoptotic processTyrosine-protein kinase HCKHomo sapiens (human)
leukocyte degranulationTyrosine-protein kinase HCKHomo sapiens (human)
respiratory burst after phagocytosisTyrosine-protein kinase HCKHomo sapiens (human)
protein autophosphorylationTyrosine-protein kinase HCKHomo sapiens (human)
regulation of inflammatory responseTyrosine-protein kinase HCKHomo sapiens (human)
regulation of phagocytosisTyrosine-protein kinase HCKHomo sapiens (human)
regulation of DNA-binding transcription factor activityTyrosine-protein kinase HCKHomo sapiens (human)
type II interferon-mediated signaling pathwayTyrosine-protein kinase HCKHomo sapiens (human)
regulation of podosome assemblyTyrosine-protein kinase HCKHomo sapiens (human)
cell differentiationTyrosine-protein kinase HCKHomo sapiens (human)
innate immune responseTyrosine-protein kinase HCKHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase HCKHomo sapiens (human)
lipid hydroxylationCytochrome P450 3A4Homo sapiens (human)
lipid metabolic processCytochrome P450 3A4Homo sapiens (human)
steroid catabolic processCytochrome P450 3A4Homo sapiens (human)
xenobiotic metabolic processCytochrome P450 3A4Homo sapiens (human)
steroid metabolic processCytochrome P450 3A4Homo sapiens (human)
cholesterol metabolic processCytochrome P450 3A4Homo sapiens (human)
androgen metabolic processCytochrome P450 3A4Homo sapiens (human)
estrogen metabolic processCytochrome P450 3A4Homo sapiens (human)
alkaloid catabolic processCytochrome P450 3A4Homo sapiens (human)
monoterpenoid metabolic processCytochrome P450 3A4Homo sapiens (human)
calcitriol biosynthetic process from calciolCytochrome P450 3A4Homo sapiens (human)
xenobiotic catabolic processCytochrome P450 3A4Homo sapiens (human)
vitamin D metabolic processCytochrome P450 3A4Homo sapiens (human)
vitamin D catabolic processCytochrome P450 3A4Homo sapiens (human)
retinol metabolic processCytochrome P450 3A4Homo sapiens (human)
retinoic acid metabolic processCytochrome P450 3A4Homo sapiens (human)
long-chain fatty acid biosynthetic processCytochrome P450 3A4Homo sapiens (human)
aflatoxin metabolic processCytochrome P450 3A4Homo sapiens (human)
oxidative demethylationCytochrome P450 3A4Homo sapiens (human)
signal transductionPlatelet-derived growth factor receptor betaHomo sapiens (human)
G protein-coupled receptor signaling pathwayPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of cell population proliferationPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of phospholipase C activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of smooth muscle cell migrationPlatelet-derived growth factor receptor betaHomo sapiens (human)
peptidyl-tyrosine phosphorylationPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of cell migrationPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of phosphoprotein phosphatase activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
regulation of actin cytoskeleton organizationPlatelet-derived growth factor receptor betaHomo sapiens (human)
cell migration involved in vasculogenesisPlatelet-derived growth factor receptor betaHomo sapiens (human)
platelet-derived growth factor receptor-beta signaling pathwayPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathwayPlatelet-derived growth factor receptor betaHomo sapiens (human)
aorta morphogenesisPlatelet-derived growth factor receptor betaHomo sapiens (human)
cellular response to platelet-derived growth factor stimulusPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathwayPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of MAP kinase activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of mitotic nuclear divisionPlatelet-derived growth factor receptor betaHomo sapiens (human)
phosphatidylinositol metabolic processPlatelet-derived growth factor receptor betaHomo sapiens (human)
protein autophosphorylationPlatelet-derived growth factor receptor betaHomo sapiens (human)
platelet-derived growth factor receptor signaling pathwayPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of smooth muscle cell proliferationPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of calcium-mediated signalingPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of chemotaxisPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionPlatelet-derived growth factor receptor betaHomo sapiens (human)
cardiac myofibril assemblyPlatelet-derived growth factor receptor betaHomo sapiens (human)
cell chemotaxisPlatelet-derived growth factor receptor betaHomo sapiens (human)
cell migration involved in coronary angiogenesisPlatelet-derived growth factor receptor betaHomo sapiens (human)
retina vasculature development in camera-type eyePlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadePlatelet-derived growth factor receptor betaHomo sapiens (human)
smooth muscle cell chemotaxisPlatelet-derived growth factor receptor betaHomo sapiens (human)
metanephric glomerular mesangial cell proliferation involved in metanephros developmentPlatelet-derived growth factor receptor betaHomo sapiens (human)
metanephric glomerular capillary formationPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of calcium ion importPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of reactive oxygen species metabolic processPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of DNA biosynthetic processPlatelet-derived growth factor receptor betaHomo sapiens (human)
positive regulation of kinase activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
angiogenesisPlatelet-derived growth factor receptor betaHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayPlatelet-derived growth factor receptor betaHomo sapiens (human)
multicellular organism developmentPlatelet-derived growth factor receptor betaHomo sapiens (human)
regulation of TOR signalingSerine/threonine-protein kinase A-RafHomo sapiens (human)
regulation of proteasomal ubiquitin-dependent protein catabolic processSerine/threonine-protein kinase A-RafHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylationSerine/threonine-protein kinase A-RafHomo sapiens (human)
protein modification processSerine/threonine-protein kinase A-RafHomo sapiens (human)
negative regulation of apoptotic processSerine/threonine-protein kinase A-RafHomo sapiens (human)
MAPK cascadeSerine/threonine-protein kinase A-RafHomo sapiens (human)
lipid hydroxylationCytochrome P450 2C8Homo sapiens (human)
organic acid metabolic processCytochrome P450 2C8Homo sapiens (human)
xenobiotic metabolic processCytochrome P450 2C8Homo sapiens (human)
steroid metabolic processCytochrome P450 2C8Homo sapiens (human)
estrogen metabolic processCytochrome P450 2C8Homo sapiens (human)
epoxygenase P450 pathwayCytochrome P450 2C8Homo sapiens (human)
xenobiotic catabolic processCytochrome P450 2C8Homo sapiens (human)
retinol metabolic processCytochrome P450 2C8Homo sapiens (human)
retinoic acid metabolic processCytochrome P450 2C8Homo sapiens (human)
long-chain fatty acid biosynthetic processCytochrome P450 2C8Homo sapiens (human)
icosanoid biosynthetic processCytochrome P450 2C8Homo sapiens (human)
oxidative demethylationCytochrome P450 2C8Homo sapiens (human)
omega-hydroxylase P450 pathwayCytochrome P450 2C8Homo sapiens (human)
xenobiotic metabolic processCytochrome P450 2D6Homo sapiens (human)
steroid metabolic processCytochrome P450 2D6Homo sapiens (human)
cholesterol metabolic processCytochrome P450 2D6Homo sapiens (human)
estrogen metabolic processCytochrome P450 2D6Homo sapiens (human)
coumarin metabolic processCytochrome P450 2D6Homo sapiens (human)
alkaloid metabolic processCytochrome P450 2D6Homo sapiens (human)
alkaloid catabolic processCytochrome P450 2D6Homo sapiens (human)
monoterpenoid metabolic processCytochrome P450 2D6Homo sapiens (human)
isoquinoline alkaloid metabolic processCytochrome P450 2D6Homo sapiens (human)
xenobiotic catabolic processCytochrome P450 2D6Homo sapiens (human)
retinol metabolic processCytochrome P450 2D6Homo sapiens (human)
long-chain fatty acid biosynthetic processCytochrome P450 2D6Homo sapiens (human)
negative regulation of bindingCytochrome P450 2D6Homo sapiens (human)
oxidative demethylationCytochrome P450 2D6Homo sapiens (human)
negative regulation of cellular organofluorine metabolic processCytochrome P450 2D6Homo sapiens (human)
arachidonic acid metabolic processCytochrome P450 2D6Homo sapiens (human)
glycogen catabolic processGlycogen phosphorylase, brain formHomo sapiens (human)
negative regulation of cellular extravasationBreakpoint cluster region proteinHomo sapiens (human)
renal system processBreakpoint cluster region proteinHomo sapiens (human)
protein phosphorylationBreakpoint cluster region proteinHomo sapiens (human)
phagocytosisBreakpoint cluster region proteinHomo sapiens (human)
signal transductionBreakpoint cluster region proteinHomo sapiens (human)
small GTPase-mediated signal transductionBreakpoint cluster region proteinHomo sapiens (human)
brain developmentBreakpoint cluster region proteinHomo sapiens (human)
actin cytoskeleton organizationBreakpoint cluster region proteinHomo sapiens (human)
keratinocyte differentiationBreakpoint cluster region proteinHomo sapiens (human)
regulation of Rho protein signal transductionBreakpoint cluster region proteinHomo sapiens (human)
inner ear morphogenesisBreakpoint cluster region proteinHomo sapiens (human)
regulation of vascular permeabilityBreakpoint cluster region proteinHomo sapiens (human)
neutrophil degranulationBreakpoint cluster region proteinHomo sapiens (human)
negative regulation of neutrophil degranulationBreakpoint cluster region proteinHomo sapiens (human)
focal adhesion assemblyBreakpoint cluster region proteinHomo sapiens (human)
homeostasis of number of cellsBreakpoint cluster region proteinHomo sapiens (human)
negative regulation of inflammatory responseBreakpoint cluster region proteinHomo sapiens (human)
positive regulation of phagocytosisBreakpoint cluster region proteinHomo sapiens (human)
modulation of chemical synaptic transmissionBreakpoint cluster region proteinHomo sapiens (human)
neuromuscular process controlling balanceBreakpoint cluster region proteinHomo sapiens (human)
regulation of small GTPase mediated signal transductionBreakpoint cluster region proteinHomo sapiens (human)
regulation of cell cycleBreakpoint cluster region proteinHomo sapiens (human)
definitive hemopoiesisBreakpoint cluster region proteinHomo sapiens (human)
negative regulation of respiratory burstBreakpoint cluster region proteinHomo sapiens (human)
negative regulation of blood vessel remodelingBreakpoint cluster region proteinHomo sapiens (human)
intracellular protein transmembrane transportBreakpoint cluster region proteinHomo sapiens (human)
cellular response to lipopolysaccharideBreakpoint cluster region proteinHomo sapiens (human)
activation of GTPase activityBreakpoint cluster region proteinHomo sapiens (human)
macrophage migrationBreakpoint cluster region proteinHomo sapiens (human)
negative regulation of macrophage migrationBreakpoint cluster region proteinHomo sapiens (human)
negative regulation of reactive oxygen species metabolic processBreakpoint cluster region proteinHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase pim-1Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase pim-1Homo sapiens (human)
regulation of transmembrane transporter activitySerine/threonine-protein kinase pim-1Homo sapiens (human)
negative regulation of apoptotic processSerine/threonine-protein kinase pim-1Homo sapiens (human)
negative regulation of DNA-binding transcription factor activitySerine/threonine-protein kinase pim-1Homo sapiens (human)
negative regulation of innate immune responseSerine/threonine-protein kinase pim-1Homo sapiens (human)
positive regulation of DNA-templated transcriptionSerine/threonine-protein kinase pim-1Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase pim-1Homo sapiens (human)
protein stabilizationSerine/threonine-protein kinase pim-1Homo sapiens (human)
positive regulation of cardiac muscle cell proliferationSerine/threonine-protein kinase pim-1Homo sapiens (human)
vitamin D receptor signaling pathwaySerine/threonine-protein kinase pim-1Homo sapiens (human)
cellular response to type II interferonSerine/threonine-protein kinase pim-1Homo sapiens (human)
positive regulation of brown fat cell differentiationSerine/threonine-protein kinase pim-1Homo sapiens (human)
regulation of hematopoietic stem cell proliferationSerine/threonine-protein kinase pim-1Homo sapiens (human)
positive regulation of TORC1 signalingSerine/threonine-protein kinase pim-1Homo sapiens (human)
positive regulation of cardioblast proliferationSerine/threonine-protein kinase pim-1Homo sapiens (human)
cellular detoxificationSerine/threonine-protein kinase pim-1Homo sapiens (human)
positive regulation of cell population proliferationFibroblast growth factor receptor 1Homo sapiens (human)
fibroblast growth factor receptor signaling pathwayFibroblast growth factor receptor 1Homo sapiens (human)
negative regulation of transcription by RNA polymerase IIFibroblast growth factor receptor 1Homo sapiens (human)
MAPK cascadeFibroblast growth factor receptor 1Homo sapiens (human)
skeletal system developmentFibroblast growth factor receptor 1Homo sapiens (human)
angiogenesisFibroblast growth factor receptor 1Homo sapiens (human)
ureteric bud developmentFibroblast growth factor receptor 1Homo sapiens (human)
in utero embryonic developmentFibroblast growth factor receptor 1Homo sapiens (human)
organ inductionFibroblast growth factor receptor 1Homo sapiens (human)
neuron migrationFibroblast growth factor receptor 1Homo sapiens (human)
epithelial to mesenchymal transitionFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of mesenchymal cell proliferationFibroblast growth factor receptor 1Homo sapiens (human)
chondrocyte differentiationFibroblast growth factor receptor 1Homo sapiens (human)
protein phosphorylationFibroblast growth factor receptor 1Homo sapiens (human)
sensory perception of soundFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of cell population proliferationFibroblast growth factor receptor 1Homo sapiens (human)
fibroblast growth factor receptor signaling pathwayFibroblast growth factor receptor 1Homo sapiens (human)
mesenchymal cell proliferationFibroblast growth factor receptor 1Homo sapiens (human)
gene expressionFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of phospholipase activityFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of phospholipase C activityFibroblast growth factor receptor 1Homo sapiens (human)
regulation of phosphate transportFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of neuron projection developmentFibroblast growth factor receptor 1Homo sapiens (human)
cell migrationFibroblast growth factor receptor 1Homo sapiens (human)
peptidyl-tyrosine phosphorylationFibroblast growth factor receptor 1Homo sapiens (human)
ventricular zone neuroblast divisionFibroblast growth factor receptor 1Homo sapiens (human)
cell projection assemblyFibroblast growth factor receptor 1Homo sapiens (human)
embryonic limb morphogenesisFibroblast growth factor receptor 1Homo sapiens (human)
midbrain developmentFibroblast growth factor receptor 1Homo sapiens (human)
neuron projection developmentFibroblast growth factor receptor 1Homo sapiens (human)
fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex developmentFibroblast growth factor receptor 1Homo sapiens (human)
inner ear morphogenesisFibroblast growth factor receptor 1Homo sapiens (human)
outer ear morphogenesisFibroblast growth factor receptor 1Homo sapiens (human)
middle ear morphogenesisFibroblast growth factor receptor 1Homo sapiens (human)
chordate embryonic developmentFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of MAP kinase activityFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of MAPK cascadeFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of blood vessel endothelial cell migrationFibroblast growth factor receptor 1Homo sapiens (human)
cellular response to fibroblast growth factor stimulusFibroblast growth factor receptor 1Homo sapiens (human)
regulation of cell differentiationFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of neuron differentiationFibroblast growth factor receptor 1Homo sapiens (human)
protein autophosphorylationFibroblast growth factor receptor 1Homo sapiens (human)
phosphatidylinositol-mediated signalingFibroblast growth factor receptor 1Homo sapiens (human)
paraxial mesoderm developmentFibroblast growth factor receptor 1Homo sapiens (human)
regulation of lateral mesodermal cell fate specificationFibroblast growth factor receptor 1Homo sapiens (human)
cell maturationFibroblast growth factor receptor 1Homo sapiens (human)
skeletal system morphogenesisFibroblast growth factor receptor 1Homo sapiens (human)
stem cell differentiationFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionFibroblast growth factor receptor 1Homo sapiens (human)
calcium ion homeostasisFibroblast growth factor receptor 1Homo sapiens (human)
cardiac muscle cell proliferationFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of cardiac muscle cell proliferationFibroblast growth factor receptor 1Homo sapiens (human)
auditory receptor cell developmentFibroblast growth factor receptor 1Homo sapiens (human)
branching involved in salivary gland morphogenesisFibroblast growth factor receptor 1Homo sapiens (human)
lung-associated mesenchyme developmentFibroblast growth factor receptor 1Homo sapiens (human)
regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signalingFibroblast growth factor receptor 1Homo sapiens (human)
vitamin D3 metabolic processFibroblast growth factor receptor 1Homo sapiens (human)
diphosphate metabolic processFibroblast growth factor receptor 1Homo sapiens (human)
cementum mineralizationFibroblast growth factor receptor 1Homo sapiens (human)
stem cell proliferationFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathwayFibroblast growth factor receptor 1Homo sapiens (human)
negative regulation of fibroblast growth factor productionFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of mitotic cell cycle DNA replicationFibroblast growth factor receptor 1Homo sapiens (human)
response to sodium phosphateFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of vascular endothelial cell proliferationFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of stem cell proliferationFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of parathyroid hormone secretionFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of endothelial cell chemotaxisFibroblast growth factor receptor 1Homo sapiens (human)
regulation of extrinsic apoptotic signaling pathway in absence of ligandFibroblast growth factor receptor 1Homo sapiens (human)
multicellular organism developmentFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of cell differentiationFibroblast growth factor receptor 1Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayFibroblast growth factor receptor 1Homo sapiens (human)
positive regulation of kinase activityFibroblast growth factor receptor 1Homo sapiens (human)
xenobiotic metabolic processCytochrome P450 2C9 Homo sapiens (human)
steroid metabolic processCytochrome P450 2C9 Homo sapiens (human)
cholesterol metabolic processCytochrome P450 2C9 Homo sapiens (human)
estrogen metabolic processCytochrome P450 2C9 Homo sapiens (human)
monoterpenoid metabolic processCytochrome P450 2C9 Homo sapiens (human)
epoxygenase P450 pathwayCytochrome P450 2C9 Homo sapiens (human)
urea metabolic processCytochrome P450 2C9 Homo sapiens (human)
monocarboxylic acid metabolic processCytochrome P450 2C9 Homo sapiens (human)
xenobiotic catabolic processCytochrome P450 2C9 Homo sapiens (human)
long-chain fatty acid biosynthetic processCytochrome P450 2C9 Homo sapiens (human)
amide metabolic processCytochrome P450 2C9 Homo sapiens (human)
icosanoid biosynthetic processCytochrome P450 2C9 Homo sapiens (human)
oxidative demethylationCytochrome P450 2C9 Homo sapiens (human)
omega-hydroxylase P450 pathwayCytochrome P450 2C9 Homo sapiens (human)
G1/S transition of mitotic cell cycleCyclin-dependent kinase 4Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 4Homo sapiens (human)
positive regulation of cell population proliferationCyclin-dependent kinase 4Homo sapiens (human)
response to xenobiotic stimulusCyclin-dependent kinase 4Homo sapiens (human)
regulation of gene expressionCyclin-dependent kinase 4Homo sapiens (human)
positive regulation of G2/M transition of mitotic cell cycleCyclin-dependent kinase 4Homo sapiens (human)
positive regulation of fibroblast proliferationCyclin-dependent kinase 4Homo sapiens (human)
cell divisionCyclin-dependent kinase 4Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 4Homo sapiens (human)
regulation of transcription initiation by RNA polymerase IICyclin-dependent kinase 4Homo sapiens (human)
regulation of type B pancreatic cell proliferationCyclin-dependent kinase 4Homo sapiens (human)
cellular response to lipopolysaccharideCyclin-dependent kinase 4Homo sapiens (human)
cellular response to interleukin-4Cyclin-dependent kinase 4Homo sapiens (human)
cellular response to phorbol 13-acetate 12-myristateCyclin-dependent kinase 4Homo sapiens (human)
cellular response to ionomycinCyclin-dependent kinase 4Homo sapiens (human)
response to organic substanceCyclin-dependent kinase 4Homo sapiens (human)
regulation of G2/M transition of mitotic cell cycleCyclin-dependent kinase 4Homo sapiens (human)
signal transductionCyclin-dependent kinase 4Homo sapiens (human)
apoptotic processADP/ATP translocase 3Homo sapiens (human)
mitochondrial ADP transmembrane transportADP/ATP translocase 3Homo sapiens (human)
mitochondrial ATP transmembrane transportADP/ATP translocase 3Homo sapiens (human)
negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathwayADP/ATP translocase 3Homo sapiens (human)
GMP biosynthetic processInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
GTP biosynthetic processInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
circadian rhythmInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
lymphocyte proliferationInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
cellular response to interleukin-4Inosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
'de novo' XMP biosynthetic processInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
peptidyl-tyrosine phosphorylationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
primary ovarian follicle growthProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of cytokine productionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
stimulatory C-type lectin receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
signal transductionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
signal complex assemblyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
epidermal growth factor receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
transforming growth factor beta receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
integrin-mediated signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
spermatogenesisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
learning or memoryProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
response to xenobiotic stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
response to mechanical stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
response to acidic pHProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of gene expressionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of epithelial cell migrationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of epithelial cell migrationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of glucose metabolic processProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of protein processingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
skeletal muscle cell proliferationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of smooth muscle cell migrationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
macroautophagyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
peptidyl-tyrosine phosphorylationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of cell-cell adhesionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
platelet activationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
forebrain developmentProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
T cell costimulationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of protein-containing complex assemblyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
protein destabilizationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
response to nutrient levelsProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of telomere maintenance via telomeraseProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to insulin stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of intracellular estrogen receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of integrin activationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of toll-like receptor 3 signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
adherens junction organizationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
substrate adhesion-dependent cell spreadingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of dephosphorylationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of hippo signalingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
intracellular signal transductionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
entry of bacterium into host cellProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
osteoclast developmentProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to platelet-derived growth factor stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
ERBB2 signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
angiotensin-activated signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
odontogenesisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of apoptotic processProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of apoptotic processProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of vascular permeabilityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
stress fiber assemblyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in apoptotic processProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
transcytosisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of bone resorptionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
bone resorptionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of Notch signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of bone resorptionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of Ras protein signal transductionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of insulin receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
protein autophosphorylationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
platelet-derived growth factor receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
neurotrophin TRK receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
ephrin receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
focal adhesion assemblyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
oogenesisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
progesterone receptor signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
leukocyte migrationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of small GTPase mediated signal transductionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of protein transportProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
response to mineralocorticoidProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
myoblast proliferationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
response to electrical stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of focal adhesion assemblyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of mitochondrial depolarizationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of telomerase activityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
uterus developmentProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
branching involved in mammary gland duct morphogenesisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of cell projection assemblyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
intestinal epithelial cell developmentProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
interleukin-6-mediated signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to hydrogen peroxideProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
response to interleukin-1Proto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to lipopolysaccharideProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to peptide hormone stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to progesterone stimulusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to fatty acidProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to hypoxiaProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to fluid shear stressProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of podosome assemblyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
DNA biosynthetic processProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of protein serine/threonine kinase activityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of heart rate by cardiac conductionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of canonical Wnt signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cell-cell adhesionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of protein localization to nucleusProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of non-membrane spanning protein tyrosine kinase activityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of TORC1 signalingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cellular response to prolactinProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of male germ cell proliferationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of ovarian follicle developmentProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of lamellipodium morphogenesisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
positive regulation of platelet-derived growth factor receptor-beta signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of early endosome to late endosome transportProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of anoikisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
negative regulation of intrinsic apoptotic signaling pathwayProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of caveolin-mediated endocytosisProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cell differentiationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cell adhesionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
innate immune responseProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
protein phosphorylationProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
symbiont entry into host cellProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
regulation of protein phosphorylationcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
intracellular signal transductioncAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
negative regulation of cAMP/PKA signal transductioncAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
negative regulation of cAMP-dependent protein kinase activitycAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
MAPK cascadeSerine/threonine-protein kinase B-rafHomo sapiens (human)
myeloid progenitor cell differentiationSerine/threonine-protein kinase B-rafHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase B-rafHomo sapiens (human)
epidermal growth factor receptor signaling pathwaySerine/threonine-protein kinase B-rafHomo sapiens (human)
visual learningSerine/threonine-protein kinase B-rafHomo sapiens (human)
animal organ morphogenesisSerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of gene expressionSerine/threonine-protein kinase B-rafHomo sapiens (human)
negative regulation of fibroblast migrationSerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of glucose transmembrane transportSerine/threonine-protein kinase B-rafHomo sapiens (human)
synaptic vesicle exocytosisSerine/threonine-protein kinase B-rafHomo sapiens (human)
thyroid gland developmentSerine/threonine-protein kinase B-rafHomo sapiens (human)
T cell differentiation in thymusSerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylationSerine/threonine-protein kinase B-rafHomo sapiens (human)
substrate adhesion-dependent cell spreadingSerine/threonine-protein kinase B-rafHomo sapiens (human)
somatic stem cell population maintenanceSerine/threonine-protein kinase B-rafHomo sapiens (human)
regulation of cell population proliferationSerine/threonine-protein kinase B-rafHomo sapiens (human)
negative regulation of apoptotic processSerine/threonine-protein kinase B-rafHomo sapiens (human)
stress fiber assemblySerine/threonine-protein kinase B-rafHomo sapiens (human)
CD4-positive, alpha-beta T cell differentiationSerine/threonine-protein kinase B-rafHomo sapiens (human)
CD4-positive or CD8-positive, alpha-beta T cell lineage commitmentSerine/threonine-protein kinase B-rafHomo sapiens (human)
response to peptide hormoneSerine/threonine-protein kinase B-rafHomo sapiens (human)
negative regulation of neuron apoptotic processSerine/threonine-protein kinase B-rafHomo sapiens (human)
regulation of T cell differentiationSerine/threonine-protein kinase B-rafHomo sapiens (human)
thymus developmentSerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of axon regenerationSerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of axonogenesisSerine/threonine-protein kinase B-rafHomo sapiens (human)
T cell receptor signaling pathwaySerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of stress fiber assemblySerine/threonine-protein kinase B-rafHomo sapiens (human)
response to cAMPSerine/threonine-protein kinase B-rafHomo sapiens (human)
long-term synaptic potentiationSerine/threonine-protein kinase B-rafHomo sapiens (human)
head morphogenesisSerine/threonine-protein kinase B-rafHomo sapiens (human)
face developmentSerine/threonine-protein kinase B-rafHomo sapiens (human)
ERK1 and ERK2 cascadeSerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeSerine/threonine-protein kinase B-rafHomo sapiens (human)
cellular response to calcium ionSerine/threonine-protein kinase B-rafHomo sapiens (human)
cellular response to xenobiotic stimulusSerine/threonine-protein kinase B-rafHomo sapiens (human)
endothelial cell apoptotic processSerine/threonine-protein kinase B-rafHomo sapiens (human)
establishment of protein localization to membraneSerine/threonine-protein kinase B-rafHomo sapiens (human)
positive regulation of substrate adhesion-dependent cell spreadingSerine/threonine-protein kinase B-rafHomo sapiens (human)
cellular response to nerve growth factor stimulusSerine/threonine-protein kinase B-rafHomo sapiens (human)
negative regulation of synaptic vesicle exocytosisSerine/threonine-protein kinase B-rafHomo sapiens (human)
negative regulation of endothelial cell apoptotic processSerine/threonine-protein kinase B-rafHomo sapiens (human)
glycogen metabolic processPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
glycogen biosynthetic processPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
glycogen catabolic processPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
generation of precursor metabolites and energyPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
protein phosphorylationPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
positive regulation of glycogen catabolic processPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
quinone catabolic processRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
microtubule cytoskeleton organizationTyrosine-protein kinase FerHomo sapiens (human)
regulation of protein phosphorylationTyrosine-protein kinase FerHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase FerHomo sapiens (human)
tyrosine phosphorylation of STAT proteinTyrosine-protein kinase FerHomo sapiens (human)
germ cell developmentTyrosine-protein kinase FerHomo sapiens (human)
positive regulation of cell population proliferationTyrosine-protein kinase FerHomo sapiens (human)
insulin receptor signaling pathwayTyrosine-protein kinase FerHomo sapiens (human)
regulation of lamellipodium assemblyTyrosine-protein kinase FerHomo sapiens (human)
regulation of fibroblast migrationTyrosine-protein kinase FerHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase FerHomo sapiens (human)
cytokine-mediated signaling pathwayTyrosine-protein kinase FerHomo sapiens (human)
actin cytoskeleton organizationTyrosine-protein kinase FerHomo sapiens (human)
positive regulation of cell migrationTyrosine-protein kinase FerHomo sapiens (human)
positive regulation of actin filament polymerizationTyrosine-protein kinase FerHomo sapiens (human)
response to lipopolysaccharideTyrosine-protein kinase FerHomo sapiens (human)
negative regulation of mast cell activation involved in immune responseTyrosine-protein kinase FerHomo sapiens (human)
adherens junction assemblyTyrosine-protein kinase FerHomo sapiens (human)
substrate adhesion-dependent cell spreadingTyrosine-protein kinase FerHomo sapiens (human)
cellular response to reactive oxygen speciesTyrosine-protein kinase FerHomo sapiens (human)
extracellular matrix-cell signalingTyrosine-protein kinase FerHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase FerHomo sapiens (human)
cellular response to macrophage colony-stimulating factor stimulusTyrosine-protein kinase FerHomo sapiens (human)
response to platelet-derived growth factorTyrosine-protein kinase FerHomo sapiens (human)
Fc-epsilon receptor signaling pathwayTyrosine-protein kinase FerHomo sapiens (human)
Kit signaling pathwayTyrosine-protein kinase FerHomo sapiens (human)
regulation of epidermal growth factor receptor signaling pathwayTyrosine-protein kinase FerHomo sapiens (human)
cell-cell adhesion mediated by cadherinTyrosine-protein kinase FerHomo sapiens (human)
protein autophosphorylationTyrosine-protein kinase FerHomo sapiens (human)
platelet-derived growth factor receptor signaling pathwayTyrosine-protein kinase FerHomo sapiens (human)
diapedesisTyrosine-protein kinase FerHomo sapiens (human)
positive regulation of NF-kappaB transcription factor activityTyrosine-protein kinase FerHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionTyrosine-protein kinase FerHomo sapiens (human)
Sertoli cell developmentTyrosine-protein kinase FerHomo sapiens (human)
interleukin-6-mediated signaling pathwayTyrosine-protein kinase FerHomo sapiens (human)
seminiferous tubule developmentTyrosine-protein kinase FerHomo sapiens (human)
adherens junction disassemblyTyrosine-protein kinase FerHomo sapiens (human)
cell adhesionTyrosine-protein kinase FerHomo sapiens (human)
chemotaxisTyrosine-protein kinase FerHomo sapiens (human)
angiogenesisProtein kinase C alpha typeHomo sapiens (human)
positive regulation of endothelial cell proliferationProtein kinase C alpha typeHomo sapiens (human)
desmosome assemblyProtein kinase C alpha typeHomo sapiens (human)
chromatin remodelingProtein kinase C alpha typeHomo sapiens (human)
protein phosphorylationProtein kinase C alpha typeHomo sapiens (human)
mitotic nuclear membrane disassemblyProtein kinase C alpha typeHomo sapiens (human)
cell adhesionProtein kinase C alpha typeHomo sapiens (human)
positive regulation of endothelial cell migrationProtein kinase C alpha typeHomo sapiens (human)
positive regulation of cardiac muscle hypertrophyProtein kinase C alpha typeHomo sapiens (human)
peptidyl-serine phosphorylationProtein kinase C alpha typeHomo sapiens (human)
peptidyl-threonine phosphorylationProtein kinase C alpha typeHomo sapiens (human)
positive regulation of cell migrationProtein kinase C alpha typeHomo sapiens (human)
positive regulation of lipopolysaccharide-mediated signaling pathwayProtein kinase C alpha typeHomo sapiens (human)
negative regulation of glial cell apoptotic processProtein kinase C alpha typeHomo sapiens (human)
regulation of mRNA stabilityProtein kinase C alpha typeHomo sapiens (human)
positive regulation of blood vessel endothelial cell migrationProtein kinase C alpha typeHomo sapiens (human)
post-translational protein modificationProtein kinase C alpha typeHomo sapiens (human)
positive regulation of macrophage differentiationProtein kinase C alpha typeHomo sapiens (human)
positive regulation of angiogenesisProtein kinase C alpha typeHomo sapiens (human)
positive regulation of bone resorptionProtein kinase C alpha typeHomo sapiens (human)
positive regulation of cell adhesionProtein kinase C alpha typeHomo sapiens (human)
positive regulation of mitotic cell cycleProtein kinase C alpha typeHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeProtein kinase C alpha typeHomo sapiens (human)
response to interleukin-1Protein kinase C alpha typeHomo sapiens (human)
regulation of platelet aggregationProtein kinase C alpha typeHomo sapiens (human)
apoptotic signaling pathwayProtein kinase C alpha typeHomo sapiens (human)
positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathwayProtein kinase C alpha typeHomo sapiens (human)
positive regulation of angiotensin-activated signaling pathwayProtein kinase C alpha typeHomo sapiens (human)
positive regulation of dense core granule biogenesisProtein kinase C alpha typeHomo sapiens (human)
intracellular signal transductionProtein kinase C alpha typeHomo sapiens (human)
positive regulation of insulin secretionProtein kinase C alpha typeHomo sapiens (human)
mesoderm formationcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
neural tube closurecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of heart ratecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
renal water homeostasiscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
mRNA processingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein phosphorylationcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein export from nucleuscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
adenylate cyclase-activating G protein-coupled receptor signaling pathwaycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of macroautophagycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
peptidyl-serine phosphorylationcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cytokine-mediated signaling pathwaycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
positive regulation of insulin secretioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
negative regulation of interleukin-2 productioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
high-density lipoprotein particle assemblycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cellular response to heatcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
mitochondrial protein catabolic processcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of osteoblast differentiationcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
positive regulation of gluconeogenesiscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
negative regulation of smoothened signaling pathwaycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
positive regulation of protein export from nucleuscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
sperm capacitationcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
positive regulation of calcium-mediated signalingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of cell cyclecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of cardiac muscle contractioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of proteasomal protein catabolic processcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cellular response to coldcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of protein processingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cellular response to glucose stimuluscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cellular response to parathyroid hormone stimuluscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cellular response to glucagon stimuluscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cellular response to epinephrine stimuluscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cell communication by electrical coupling involved in cardiac conductioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
postsynaptic modulation of chemical synaptic transmissioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of cardiac conductioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
negative regulation of TORC1 signalingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
negative regulation of glycolytic process through fructose-6-phosphatecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein localization to lipid dropletcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
regulation of bicellular tight junction assemblycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein kinase A signalingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)General transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
response to hypoxiaGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
in utero embryonic developmentGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
transcription-coupled nucleotide-excision repairGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
nucleotide-excision repairGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
regulation of transcription by RNA polymerase IIGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
transcription elongation by RNA polymerase IGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
transcription by RNA polymerase IIGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
transcription initiation at RNA polymerase II promoterGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
apoptotic processGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
response to oxidative stressGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
chromosome segregationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
determination of adult lifespanGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
UV protectionGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
post-embryonic developmentGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
spinal cord developmentGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
extracellular matrix organizationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
bone mineralizationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
central nervous system myelin formationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
DNA duplex unwindingGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
multicellular organism growthGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
hair cell differentiationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
embryonic cleavageGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
erythrocyte maturationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
insulin-like growth factor receptor signaling pathwayGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
embryonic organ developmentGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
hair follicle maturationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
hematopoietic stem cell differentiationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
hematopoietic stem cell proliferationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
intrinsic apoptotic signaling pathway by p53 class mediatorGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
regulation of mitotic cell cycle phase transitionGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
positive regulation of mitotic recombinationGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
double-strand break repairCasein kinase II subunit alpha'Homo sapiens (human)
apoptotic processCasein kinase II subunit alpha'Homo sapiens (human)
spermatogenesisCasein kinase II subunit alpha'Homo sapiens (human)
Wnt signaling pathwayCasein kinase II subunit alpha'Homo sapiens (human)
cerebral cortex developmentCasein kinase II subunit alpha'Homo sapiens (human)
negative regulation of proteasomal ubiquitin-dependent protein catabolic processCasein kinase II subunit alpha'Homo sapiens (human)
liver regenerationCasein kinase II subunit alpha'Homo sapiens (human)
regulation of mitophagyCasein kinase II subunit alpha'Homo sapiens (human)
positive regulation of protein targeting to mitochondrionCasein kinase II subunit alpha'Homo sapiens (human)
regulation of chromosome separationCasein kinase II subunit alpha'Homo sapiens (human)
negative regulation of apoptotic signaling pathwayCasein kinase II subunit alpha'Homo sapiens (human)
peptidyl-threonine phosphorylationCasein kinase II subunit alpha'Homo sapiens (human)
peptidyl-serine phosphorylationCasein kinase II subunit alpha'Homo sapiens (human)
peptidyl-cysteine methylationRas-related protein Rab-6AHomo sapiens (human)
retrograde vesicle-mediated transport, Golgi to endoplasmic reticulumRas-related protein Rab-6AHomo sapiens (human)
antigen processing and presentationRas-related protein Rab-6AHomo sapiens (human)
neuron projection developmentRas-related protein Rab-6AHomo sapiens (human)
protein localization to Golgi apparatusRas-related protein Rab-6AHomo sapiens (human)
early endosome to Golgi transportRas-related protein Rab-6AHomo sapiens (human)
minus-end-directed organelle transport along microtubuleRas-related protein Rab-6AHomo sapiens (human)
protein localization to Golgi membraneRas-related protein Rab-6AHomo sapiens (human)
intracellular protein transportRas-related protein Rab-6AHomo sapiens (human)
intra-Golgi vesicle-mediated transportRas-related protein Rab-6AHomo sapiens (human)
retrograde transport, endosome to GolgiRas-related protein Rab-6AHomo sapiens (human)
xenobiotic metabolic processCytochrome P450 2B6Homo sapiens (human)
steroid metabolic processCytochrome P450 2B6Homo sapiens (human)
xenobiotic catabolic processCytochrome P450 2B6Homo sapiens (human)
cellular ketone metabolic processCytochrome P450 2B6Homo sapiens (human)
epoxygenase P450 pathwayCytochrome P450 2B6Homo sapiens (human)
positive regulation of cell-matrix adhesionEphrin type-A receptor 1Homo sapiens (human)
negative regulation of protein kinase activityEphrin type-A receptor 1Homo sapiens (human)
cell surface receptor signaling pathwayEphrin type-A receptor 1Homo sapiens (human)
positive regulation of cell population proliferationEphrin type-A receptor 1Homo sapiens (human)
peptidyl-tyrosine phosphorylationEphrin type-A receptor 1Homo sapiens (human)
positive regulation of cell migrationEphrin type-A receptor 1Homo sapiens (human)
negative regulation of cell migrationEphrin type-A receptor 1Homo sapiens (human)
substrate adhesion-dependent cell spreadingEphrin type-A receptor 1Homo sapiens (human)
regulation of GTPase activityEphrin type-A receptor 1Homo sapiens (human)
positive regulation of angiogenesisEphrin type-A receptor 1Homo sapiens (human)
protein autophosphorylationEphrin type-A receptor 1Homo sapiens (human)
positive regulation of stress fiber assemblyEphrin type-A receptor 1Homo sapiens (human)
activation of GTPase activityEphrin type-A receptor 1Homo sapiens (human)
positive regulation of kinase activityEphrin type-A receptor 1Homo sapiens (human)
multicellular organism developmentEphrin type-A receptor 1Homo sapiens (human)
angiogenesisEphrin type-A receptor 1Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-A receptor 1Homo sapiens (human)
GMP biosynthetic processMultifunctional protein ADE2Homo sapiens (human)
'de novo' IMP biosynthetic processMultifunctional protein ADE2Homo sapiens (human)
purine nucleobase biosynthetic processMultifunctional protein ADE2Homo sapiens (human)
'de novo' AMP biosynthetic processMultifunctional protein ADE2Homo sapiens (human)
'de novo' XMP biosynthetic processMultifunctional protein ADE2Homo sapiens (human)
renal water homeostasiscAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
spermatogenesiscAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
male gonad developmentcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
high-density lipoprotein particle assemblycAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
protein kinase A signalingcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
neural tube closurecAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
renal water homeostasiscAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
protein phosphorylationcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
signal transductioncAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
adenylate cyclase-modulating G protein-coupled receptor signaling pathwaycAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
high-density lipoprotein particle assemblycAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
negative regulation of smoothened signaling pathwaycAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
regulation of protein processingcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
negative regulation of TORC1 signalingcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
protein kinase A signalingcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
generation of precursor metabolites and energyFerrochelatase, mitochondrialHomo sapiens (human)
heme biosynthetic processFerrochelatase, mitochondrialHomo sapiens (human)
heme A biosynthetic processFerrochelatase, mitochondrialHomo sapiens (human)
heme B biosynthetic processFerrochelatase, mitochondrialHomo sapiens (human)
cholesterol metabolic processFerrochelatase, mitochondrialHomo sapiens (human)
response to xenobiotic stimulusFerrochelatase, mitochondrialHomo sapiens (human)
response to light stimulusFerrochelatase, mitochondrialHomo sapiens (human)
detection of UVFerrochelatase, mitochondrialHomo sapiens (human)
response to lead ionFerrochelatase, mitochondrialHomo sapiens (human)
regulation of eIF2 alpha phosphorylation by hemeFerrochelatase, mitochondrialHomo sapiens (human)
response to insecticideFerrochelatase, mitochondrialHomo sapiens (human)
erythrocyte differentiationFerrochelatase, mitochondrialHomo sapiens (human)
very-low-density lipoprotein particle assemblyFerrochelatase, mitochondrialHomo sapiens (human)
response to ethanolFerrochelatase, mitochondrialHomo sapiens (human)
protoporphyrinogen IX metabolic processFerrochelatase, mitochondrialHomo sapiens (human)
response to arsenic-containing substanceFerrochelatase, mitochondrialHomo sapiens (human)
regulation of hemoglobin biosynthetic processFerrochelatase, mitochondrialHomo sapiens (human)
heme O biosynthetic processFerrochelatase, mitochondrialHomo sapiens (human)
response to methylmercuryFerrochelatase, mitochondrialHomo sapiens (human)
multicellular organismal-level iron ion homeostasisFerrochelatase, mitochondrialHomo sapiens (human)
response to platinum ionFerrochelatase, mitochondrialHomo sapiens (human)
cellular response to dexamethasone stimulusFerrochelatase, mitochondrialHomo sapiens (human)
G1/S transition of mitotic cell cycleRibosomal protein S6 kinase beta-1Homo sapiens (human)
behavioral fear responseRibosomal protein S6 kinase beta-1Homo sapiens (human)
skeletal muscle contractionRibosomal protein S6 kinase beta-1Homo sapiens (human)
apoptotic processRibosomal protein S6 kinase beta-1Homo sapiens (human)
signal transductionRibosomal protein S6 kinase beta-1Homo sapiens (human)
germ cell developmentRibosomal protein S6 kinase beta-1Homo sapiens (human)
long-term memoryRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to xenobiotic stimulusRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to mechanical stimulusRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to toxic substanceRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to glucoseRibosomal protein S6 kinase beta-1Homo sapiens (human)
skeletal muscle atrophyRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to electrical stimulus involved in regulation of muscle adaptationRibosomal protein S6 kinase beta-1Homo sapiens (human)
positive regulation of smooth muscle cell migrationRibosomal protein S6 kinase beta-1Homo sapiens (human)
cell migrationRibosomal protein S6 kinase beta-1Homo sapiens (human)
peptidyl-serine phosphorylationRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to nutrient levelsRibosomal protein S6 kinase beta-1Homo sapiens (human)
cellular response to nutrientRibosomal protein S6 kinase beta-1Homo sapiens (human)
TOR signalingRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to lipopolysaccharideRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to testosteroneRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to glucagonRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to tumor necrosis factorRibosomal protein S6 kinase beta-1Homo sapiens (human)
negative regulation of apoptotic processRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to L-leucineRibosomal protein S6 kinase beta-1Homo sapiens (human)
long-chain fatty acid import into cellRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to ethanolRibosomal protein S6 kinase beta-1Homo sapiens (human)
positive regulation of translationRibosomal protein S6 kinase beta-1Homo sapiens (human)
positive regulation of mitotic cell cycleRibosomal protein S6 kinase beta-1Homo sapiens (human)
positive regulation of translational initiationRibosomal protein S6 kinase beta-1Homo sapiens (human)
regulation of glucose importRibosomal protein S6 kinase beta-1Homo sapiens (human)
negative regulation of insulin receptor signaling pathwayRibosomal protein S6 kinase beta-1Homo sapiens (human)
phosphatidylinositol-mediated signalingRibosomal protein S6 kinase beta-1Homo sapiens (human)
positive regulation of skeletal muscle tissue growthRibosomal protein S6 kinase beta-1Homo sapiens (human)
positive regulation of smooth muscle cell proliferationRibosomal protein S6 kinase beta-1Homo sapiens (human)
modulation of chemical synaptic transmissionRibosomal protein S6 kinase beta-1Homo sapiens (human)
cellular response to type II interferonRibosomal protein S6 kinase beta-1Homo sapiens (human)
cellular response to growth factor stimulusRibosomal protein S6 kinase beta-1Homo sapiens (human)
cellular response to dexamethasone stimulusRibosomal protein S6 kinase beta-1Homo sapiens (human)
positive regulation of TORC1 signalingRibosomal protein S6 kinase beta-1Homo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathwayRibosomal protein S6 kinase beta-1Homo sapiens (human)
cellular response to insulin stimulusRibosomal protein S6 kinase beta-1Homo sapiens (human)
response to antibioticTyrosine-protein kinase JAK1Homo sapiens (human)
protein phosphorylationTyrosine-protein kinase JAK1Homo sapiens (human)
cell surface receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK1Homo sapiens (human)
cytokine-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
positive regulation of homotypic cell-cell adhesionTyrosine-protein kinase JAK1Homo sapiens (human)
interleukin-15-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
interleukin-4-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
interleukin-2-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
interleukin-9-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
interleukin-11-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
type III interferon-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
type II interferon-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
type I interferon-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
interleukin-6-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
T-helper 17 cell lineage commitmentTyrosine-protein kinase JAK1Homo sapiens (human)
cellular response to virusTyrosine-protein kinase JAK1Homo sapiens (human)
interleukin-10-mediated signaling pathwayTyrosine-protein kinase JAK1Homo sapiens (human)
protein localization to cell-cell junctionTyrosine-protein kinase JAK1Homo sapiens (human)
positive regulation of protein localization to nucleusTyrosine-protein kinase JAK1Homo sapiens (human)
positive regulation of sprouting angiogenesisTyrosine-protein kinase JAK1Homo sapiens (human)
intracellular signal transductionTyrosine-protein kinase JAK1Homo sapiens (human)
tyrosine phosphorylation of STAT proteinTyrosine-protein kinase JAK1Homo sapiens (human)
cell differentiationTyrosine-protein kinase JAK1Homo sapiens (human)
growth hormone receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK1Homo sapiens (human)
G1/S transition of mitotic cell cycleCyclin-dependent kinase 2Homo sapiens (human)
G2/M transition of mitotic cell cycleCyclin-dependent kinase 2Homo sapiens (human)
negative regulation of transcription by RNA polymerase IICyclin-dependent kinase 2Homo sapiens (human)
DNA replicationCyclin-dependent kinase 2Homo sapiens (human)
DNA repairCyclin-dependent kinase 2Homo sapiens (human)
chromatin remodelingCyclin-dependent kinase 2Homo sapiens (human)
DNA-templated transcriptionCyclin-dependent kinase 2Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 2Homo sapiens (human)
potassium ion transportCyclin-dependent kinase 2Homo sapiens (human)
centriole replicationCyclin-dependent kinase 2Homo sapiens (human)
Ras protein signal transductionCyclin-dependent kinase 2Homo sapiens (human)
regulation of mitotic cell cycleCyclin-dependent kinase 2Homo sapiens (human)
positive regulation of cell population proliferationCyclin-dependent kinase 2Homo sapiens (human)
peptidyl-serine phosphorylationCyclin-dependent kinase 2Homo sapiens (human)
positive regulation of heterochromatin formationCyclin-dependent kinase 2Homo sapiens (human)
mitotic G1 DNA damage checkpoint signalingCyclin-dependent kinase 2Homo sapiens (human)
positive regulation of DNA-templated DNA replication initiationCyclin-dependent kinase 2Homo sapiens (human)
telomere maintenance in response to DNA damageCyclin-dependent kinase 2Homo sapiens (human)
post-translational protein modificationCyclin-dependent kinase 2Homo sapiens (human)
positive regulation of DNA replicationCyclin-dependent kinase 2Homo sapiens (human)
positive regulation of DNA-templated transcriptionCyclin-dependent kinase 2Homo sapiens (human)
centrosome duplicationCyclin-dependent kinase 2Homo sapiens (human)
cell divisionCyclin-dependent kinase 2Homo sapiens (human)
meiotic cell cycleCyclin-dependent kinase 2Homo sapiens (human)
cellular response to nitric oxideCyclin-dependent kinase 2Homo sapiens (human)
cellular senescenceCyclin-dependent kinase 2Homo sapiens (human)
regulation of anaphase-promoting complex-dependent catabolic processCyclin-dependent kinase 2Homo sapiens (human)
regulation of G2/M transition of mitotic cell cycleCyclin-dependent kinase 2Homo sapiens (human)
signal transductionCyclin-dependent kinase 2Homo sapiens (human)
regulation of gene expressionCyclin-dependent kinase 2Homo sapiens (human)
response to organic substanceCyclin-dependent kinase 2Homo sapiens (human)
desensitization of G protein-coupled receptor signaling pathwayBeta-adrenergic receptor kinase 1Homo sapiens (human)
negative regulation of the force of heart contraction by chemical signalBeta-adrenergic receptor kinase 1Homo sapiens (human)
G protein-coupled receptor signaling pathwayBeta-adrenergic receptor kinase 1Homo sapiens (human)
G protein-coupled acetylcholine receptor signaling pathwayBeta-adrenergic receptor kinase 1Homo sapiens (human)
tachykinin receptor signaling pathwayBeta-adrenergic receptor kinase 1Homo sapiens (human)
heart developmentBeta-adrenergic receptor kinase 1Homo sapiens (human)
peptidyl-serine phosphorylationBeta-adrenergic receptor kinase 1Homo sapiens (human)
viral genome replicationBeta-adrenergic receptor kinase 1Homo sapiens (human)
receptor internalizationBeta-adrenergic receptor kinase 1Homo sapiens (human)
positive regulation of catecholamine secretionBeta-adrenergic receptor kinase 1Homo sapiens (human)
negative regulation of striated muscle contractionBeta-adrenergic receptor kinase 1Homo sapiens (human)
symbiont entry into host cellBeta-adrenergic receptor kinase 1Homo sapiens (human)
cardiac muscle contractionBeta-adrenergic receptor kinase 1Homo sapiens (human)
negative regulation of relaxation of smooth muscleBeta-adrenergic receptor kinase 1Homo sapiens (human)
regulation of the force of heart contractionBeta-adrenergic receptor kinase 1Homo sapiens (human)
protein phosphorylationBeta-adrenergic receptor kinase 1Homo sapiens (human)
P-body assemblyProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
miRNA-mediated gene silencing by inhibition of translationProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
negative regulation of translationProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
viral RNA genome packagingProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
stem cell population maintenanceProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
neuron differentiationProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
P-body assemblyProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
negative regulation of neuron differentiationProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
stress granule assemblyProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
positive regulation of macrophage chemotaxisMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of macrophage proliferationMitogen-activated protein kinase 3 Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase 3 Homo sapiens (human)
DNA-templated transcriptionMitogen-activated protein kinase 3 Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase 3 Homo sapiens (human)
apoptotic processMitogen-activated protein kinase 3 Homo sapiens (human)
insulin receptor signaling pathwayMitogen-activated protein kinase 3 Homo sapiens (human)
Schwann cell developmentMitogen-activated protein kinase 3 Homo sapiens (human)
phosphorylationMitogen-activated protein kinase 3 Homo sapiens (human)
sensory perception of painMitogen-activated protein kinase 3 Homo sapiens (human)
regulation of ossificationMitogen-activated protein kinase 3 Homo sapiens (human)
BMP signaling pathwayMitogen-activated protein kinase 3 Homo sapiens (human)
regulation of cellular pHMitogen-activated protein kinase 3 Homo sapiens (human)
thyroid gland developmentMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of cyclase activityMitogen-activated protein kinase 3 Homo sapiens (human)
lipopolysaccharide-mediated signaling pathwayMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseMitogen-activated protein kinase 3 Homo sapiens (human)
regulation of stress-activated MAPK cascadeMitogen-activated protein kinase 3 Homo sapiens (human)
cellular response to amino acid starvationMitogen-activated protein kinase 3 Homo sapiens (human)
cellular response to reactive oxygen speciesMitogen-activated protein kinase 3 Homo sapiens (human)
peptidyl-tyrosine autophosphorylationMitogen-activated protein kinase 3 Homo sapiens (human)
ERBB2-ERBB3 signaling pathwayMitogen-activated protein kinase 3 Homo sapiens (human)
outer ear morphogenesisMitogen-activated protein kinase 3 Homo sapiens (human)
myelinationMitogen-activated protein kinase 3 Homo sapiens (human)
signal transduction in response to DNA damageMitogen-activated protein kinase 3 Homo sapiens (human)
response to exogenous dsRNAMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIMitogen-activated protein kinase 3 Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayMitogen-activated protein kinase 3 Homo sapiens (human)
thymus developmentMitogen-activated protein kinase 3 Homo sapiens (human)
modulation of chemical synaptic transmissionMitogen-activated protein kinase 3 Homo sapiens (human)
cartilage developmentMitogen-activated protein kinase 3 Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase 3 Homo sapiens (human)
regulation of cytoskeleton organizationMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of telomerase activityMitogen-activated protein kinase 3 Homo sapiens (human)
Bergmann glial cell differentiationMitogen-activated protein kinase 3 Homo sapiens (human)
face developmentMitogen-activated protein kinase 3 Homo sapiens (human)
lung morphogenesisMitogen-activated protein kinase 3 Homo sapiens (human)
trachea formationMitogen-activated protein kinase 3 Homo sapiens (human)
cardiac neural crest cell development involved in heart developmentMitogen-activated protein kinase 3 Homo sapiens (human)
ERK1 and ERK2 cascadeMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeMitogen-activated protein kinase 3 Homo sapiens (human)
interleukin-1-mediated signaling pathwayMitogen-activated protein kinase 3 Homo sapiens (human)
response to epidermal growth factorMitogen-activated protein kinase 3 Homo sapiens (human)
cellular response to mechanical stimulusMitogen-activated protein kinase 3 Homo sapiens (human)
cellular response to cadmium ionMitogen-activated protein kinase 3 Homo sapiens (human)
cellular response to tumor necrosis factorMitogen-activated protein kinase 3 Homo sapiens (human)
caveolin-mediated endocytosisMitogen-activated protein kinase 3 Homo sapiens (human)
regulation of Golgi inheritanceMitogen-activated protein kinase 3 Homo sapiens (human)
xenophagyMitogen-activated protein kinase 3 Homo sapiens (human)
negative regulation of TORC1 signalingMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of telomere cappingMitogen-activated protein kinase 3 Homo sapiens (human)
positive regulation of xenophagyMitogen-activated protein kinase 3 Homo sapiens (human)
regulation of early endosome to late endosome transportMitogen-activated protein kinase 3 Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase 3 Homo sapiens (human)
protein phosphorylationMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
peptidyl-serine phosphorylationMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
positive regulation of protein bindingMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
negative regulation of hippo signalingMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
peptidyl-serine autophosphorylationMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
negative regulation of protein localization to nucleusMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
intracellular signal transductionMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
pyrimidine nucleotide metabolic processDeoxycytidine kinaseHomo sapiens (human)
CMP biosynthetic processDeoxycytidine kinaseHomo sapiens (human)
dAMP salvageDeoxycytidine kinaseHomo sapiens (human)
nucleoside phosphate biosynthetic processDeoxycytidine kinaseHomo sapiens (human)
positive regulation of macrophage chemotaxisMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of macrophage proliferationMitogen-activated protein kinase 1Homo sapiens (human)
regulation of transcription by RNA polymerase IIMitogen-activated protein kinase 1Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
apoptotic processMitogen-activated protein kinase 1Homo sapiens (human)
chemotaxisMitogen-activated protein kinase 1Homo sapiens (human)
DNA damage responseMitogen-activated protein kinase 1Homo sapiens (human)
signal transductionMitogen-activated protein kinase 1Homo sapiens (human)
chemical synaptic transmissionMitogen-activated protein kinase 1Homo sapiens (human)
learning or memoryMitogen-activated protein kinase 1Homo sapiens (human)
insulin receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of peptidyl-threonine phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
Schwann cell developmentMitogen-activated protein kinase 1Homo sapiens (human)
peptidyl-serine phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
peptidyl-threonine phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
cytosine metabolic processMitogen-activated protein kinase 1Homo sapiens (human)
regulation of ossificationMitogen-activated protein kinase 1Homo sapiens (human)
androgen receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
regulation of cellular pHMitogen-activated protein kinase 1Homo sapiens (human)
thyroid gland developmentMitogen-activated protein kinase 1Homo sapiens (human)
regulation of protein stabilityMitogen-activated protein kinase 1Homo sapiens (human)
lipopolysaccharide-mediated signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseMitogen-activated protein kinase 1Homo sapiens (human)
regulation of stress-activated MAPK cascadeMitogen-activated protein kinase 1Homo sapiens (human)
mammary gland epithelial cell proliferationMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to amino acid starvationMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to reactive oxygen speciesMitogen-activated protein kinase 1Homo sapiens (human)
response to nicotineMitogen-activated protein kinase 1Homo sapiens (human)
ERBB signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
ERBB2-ERBB3 signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
outer ear morphogenesisMitogen-activated protein kinase 1Homo sapiens (human)
myelinationMitogen-activated protein kinase 1Homo sapiens (human)
response to exogenous dsRNAMitogen-activated protein kinase 1Homo sapiens (human)
steroid hormone mediated signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
negative regulation of cell differentiationMitogen-activated protein kinase 1Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
thymus developmentMitogen-activated protein kinase 1Homo sapiens (human)
progesterone receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
T cell receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
B cell receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase 1Homo sapiens (human)
regulation of cytoskeleton organizationMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of telomerase activityMitogen-activated protein kinase 1Homo sapiens (human)
Bergmann glial cell differentiationMitogen-activated protein kinase 1Homo sapiens (human)
long-term synaptic potentiationMitogen-activated protein kinase 1Homo sapiens (human)
face developmentMitogen-activated protein kinase 1Homo sapiens (human)
lung morphogenesisMitogen-activated protein kinase 1Homo sapiens (human)
trachea formationMitogen-activated protein kinase 1Homo sapiens (human)
labyrinthine layer blood vessel developmentMitogen-activated protein kinase 1Homo sapiens (human)
cardiac neural crest cell development involved in heart developmentMitogen-activated protein kinase 1Homo sapiens (human)
ERK1 and ERK2 cascadeMitogen-activated protein kinase 1Homo sapiens (human)
response to epidermal growth factorMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to cadmium ionMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to tumor necrosis factorMitogen-activated protein kinase 1Homo sapiens (human)
caveolin-mediated endocytosisMitogen-activated protein kinase 1Homo sapiens (human)
regulation of Golgi inheritanceMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of telomere cappingMitogen-activated protein kinase 1Homo sapiens (human)
regulation of early endosome to late endosome transportMitogen-activated protein kinase 1Homo sapiens (human)
cell surface receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase 1Homo sapiens (human)
skeletal system developmentEphrin type-A receptor 2Homo sapiens (human)
vasculogenesisEphrin type-A receptor 2Homo sapiens (human)
osteoblast differentiationEphrin type-A receptor 2Homo sapiens (human)
blood vessel endothelial cell proliferation involved in sprouting angiogenesisEphrin type-A receptor 2Homo sapiens (human)
inflammatory responseEphrin type-A receptor 2Homo sapiens (human)
cell adhesionEphrin type-A receptor 2Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to DNA damageEphrin type-A receptor 2Homo sapiens (human)
regulation of lamellipodium assemblyEphrin type-A receptor 2Homo sapiens (human)
notochord formationEphrin type-A receptor 2Homo sapiens (human)
cell migrationEphrin type-A receptor 2Homo sapiens (human)
negative regulation of angiogenesisEphrin type-A receptor 2Homo sapiens (human)
neural tube developmentEphrin type-A receptor 2Homo sapiens (human)
neuron differentiationEphrin type-A receptor 2Homo sapiens (human)
keratinocyte differentiationEphrin type-A receptor 2Homo sapiens (human)
osteoclast differentiationEphrin type-A receptor 2Homo sapiens (human)
positive regulation of cell migrationEphrin type-A receptor 2Homo sapiens (human)
negative regulation of chemokine productionEphrin type-A receptor 2Homo sapiens (human)
mammary gland epithelial cell proliferationEphrin type-A receptor 2Homo sapiens (human)
regulation of cell adhesion mediated by integrinEphrin type-A receptor 2Homo sapiens (human)
post-anal tail morphogenesisEphrin type-A receptor 2Homo sapiens (human)
regulation of blood vessel endothelial cell migrationEphrin type-A receptor 2Homo sapiens (human)
regulation of angiogenesisEphrin type-A receptor 2Homo sapiens (human)
cAMP metabolic processEphrin type-A receptor 2Homo sapiens (human)
symbiont entry into host cellEphrin type-A receptor 2Homo sapiens (human)
bone remodelingEphrin type-A receptor 2Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-A receptor 2Homo sapiens (human)
axial mesoderm formationEphrin type-A receptor 2Homo sapiens (human)
cell motilityEphrin type-A receptor 2Homo sapiens (human)
defense response to Gram-positive bacteriumEphrin type-A receptor 2Homo sapiens (human)
notochord cell developmentEphrin type-A receptor 2Homo sapiens (human)
cell chemotaxisEphrin type-A receptor 2Homo sapiens (human)
branching involved in mammary gland duct morphogenesisEphrin type-A receptor 2Homo sapiens (human)
lens fiber cell morphogenesisEphrin type-A receptor 2Homo sapiens (human)
regulation of ERK1 and ERK2 cascadeEphrin type-A receptor 2Homo sapiens (human)
response to growth factorEphrin type-A receptor 2Homo sapiens (human)
protein localization to plasma membraneEphrin type-A receptor 2Homo sapiens (human)
activation of GTPase activityEphrin type-A receptor 2Homo sapiens (human)
negative regulation of lymphangiogenesisEphrin type-A receptor 2Homo sapiens (human)
positive regulation of protein localization to plasma membraneEphrin type-A receptor 2Homo sapiens (human)
positive regulation of bicellular tight junction assemblyEphrin type-A receptor 2Homo sapiens (human)
pericyte cell differentiationEphrin type-A receptor 2Homo sapiens (human)
positive regulation of kinase activityEphrin type-A receptor 2Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayEphrin type-A receptor 2Homo sapiens (human)
multicellular organism developmentEphrin type-A receptor 2Homo sapiens (human)
negative regulation of protein kinase activityEphrin type-B receptor 2Homo sapiens (human)
regulation of autophagosome assemblyEphrin type-B receptor 2Homo sapiens (human)
angiogenesisEphrin type-B receptor 2Homo sapiens (human)
urogenital system developmentEphrin type-B receptor 2Homo sapiens (human)
negative regulation of protein phosphorylationEphrin type-B receptor 2Homo sapiens (human)
positive regulation of immunoglobulin productionEphrin type-B receptor 2Homo sapiens (human)
negative regulation of cell adhesionEphrin type-B receptor 2Homo sapiens (human)
nervous system developmentEphrin type-B receptor 2Homo sapiens (human)
axon guidanceEphrin type-B receptor 2Homo sapiens (human)
axonal fasciculationEphrin type-B receptor 2Homo sapiens (human)
learning or memoryEphrin type-B receptor 2Homo sapiens (human)
learningEphrin type-B receptor 2Homo sapiens (human)
positive regulation of gene expressionEphrin type-B receptor 2Homo sapiens (human)
phosphorylationEphrin type-B receptor 2Homo sapiens (human)
peptidyl-tyrosine phosphorylationEphrin type-B receptor 2Homo sapiens (human)
optic nerve morphogenesisEphrin type-B receptor 2Homo sapiens (human)
hindbrain tangential cell migrationEphrin type-B receptor 2Homo sapiens (human)
central nervous system projection neuron axonogenesisEphrin type-B receptor 2Homo sapiens (human)
corpus callosum developmentEphrin type-B receptor 2Homo sapiens (human)
regulation of blood coagulationEphrin type-B receptor 2Homo sapiens (human)
positive regulation of cell migrationEphrin type-B receptor 2Homo sapiens (human)
positive regulation of B cell proliferationEphrin type-B receptor 2Homo sapiens (human)
retinal ganglion cell axon guidanceEphrin type-B receptor 2Homo sapiens (human)
positive regulation of synaptic plasticityEphrin type-B receptor 2Homo sapiens (human)
positive regulation of tumor necrosis factor productionEphrin type-B receptor 2Homo sapiens (human)
B cell activationEphrin type-B receptor 2Homo sapiens (human)
inner ear morphogenesisEphrin type-B receptor 2Homo sapiens (human)
regulation of receptor signaling pathway via JAK-STATEphrin type-B receptor 2Homo sapiens (human)
negative regulation of Ras protein signal transductionEphrin type-B receptor 2Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-B receptor 2Homo sapiens (human)
regulation of neuronal synaptic plasticityEphrin type-B receptor 2Homo sapiens (human)
positive regulation of long-term neuronal synaptic plasticityEphrin type-B receptor 2Homo sapiens (human)
camera-type eye morphogenesisEphrin type-B receptor 2Homo sapiens (human)
negative regulation of axonogenesisEphrin type-B receptor 2Homo sapiens (human)
regulation of body fluid levelsEphrin type-B receptor 2Homo sapiens (human)
regulation of filopodium assemblyEphrin type-B receptor 2Homo sapiens (human)
positive regulation of synapse assemblyEphrin type-B receptor 2Homo sapiens (human)
roof of mouth developmentEphrin type-B receptor 2Homo sapiens (human)
dendritic spine developmentEphrin type-B receptor 2Homo sapiens (human)
dendritic spine morphogenesisEphrin type-B receptor 2Homo sapiens (human)
positive regulation of dendritic spine morphogenesisEphrin type-B receptor 2Homo sapiens (human)
negative regulation of ERK1 and ERK2 cascadeEphrin type-B receptor 2Homo sapiens (human)
cellular response to lipopolysaccharideEphrin type-B receptor 2Homo sapiens (human)
commissural neuron axon guidanceEphrin type-B receptor 2Homo sapiens (human)
postsynaptic membrane assemblyEphrin type-B receptor 2Homo sapiens (human)
trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmissionEphrin type-B receptor 2Homo sapiens (human)
neuron projection retractionEphrin type-B receptor 2Homo sapiens (human)
vesicle-mediated intercellular transportEphrin type-B receptor 2Homo sapiens (human)
tight junction assemblyEphrin type-B receptor 2Homo sapiens (human)
negative regulation of cytokine production involved in inflammatory responseEphrin type-B receptor 2Homo sapiens (human)
positive regulation of long-term synaptic potentiationEphrin type-B receptor 2Homo sapiens (human)
positive regulation of protein localization to plasma membraneEphrin type-B receptor 2Homo sapiens (human)
cellular response to amyloid-betaEphrin type-B receptor 2Homo sapiens (human)
negative regulation of NMDA glutamate receptor activityEphrin type-B receptor 2Homo sapiens (human)
positive regulation of NMDA glutamate receptor activityEphrin type-B receptor 2Homo sapiens (human)
positive regulation of protein localization to cell surfaceEphrin type-B receptor 2Homo sapiens (human)
regulation of T-helper 17 type immune responseEphrin type-B receptor 2Homo sapiens (human)
regulation of behavioral fear responseEphrin type-B receptor 2Homo sapiens (human)
protein phosphorylationEphrin type-B receptor 2Homo sapiens (human)
protein phosphorylationNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
immune responseNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cell surface receptor signaling pathway via JAK-STATNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cytokine-mediated signaling pathwayNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of type II interferon productionNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of interleukin-17 productionNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of natural killer cell proliferationNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
interleukin-12-mediated signaling pathwayNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
type III interferon-mediated signaling pathwayNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of T cell proliferationNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of receptor signaling pathway via JAK-STATNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of NK T cell proliferationNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
type II interferon-mediated signaling pathwayNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
type I interferon-mediated signaling pathwayNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cellular response to virusNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
interleukin-10-mediated signaling pathwayNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of protein localization to nucleusNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
positive regulation of T-helper 17 type immune responseNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
intracellular signal transductionNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cell differentiationNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
growth hormone receptor signaling pathway via JAK-STATNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
'de novo' pyrimidine nucleobase biosynthetic processUMP-CMP kinase Homo sapiens (human)
UMP biosynthetic processUMP-CMP kinase Homo sapiens (human)
UDP biosynthetic processUMP-CMP kinase Homo sapiens (human)
pyrimidine ribonucleotide biosynthetic processUMP-CMP kinase Homo sapiens (human)
nucleobase-containing small molecule interconversionUMP-CMP kinase Homo sapiens (human)
nucleoside monophosphate phosphorylationUMP-CMP kinase Homo sapiens (human)
CDP biosynthetic processUMP-CMP kinase Homo sapiens (human)
negative regulation of MAPK cascadePhosphatidylethanolamine-binding protein 1Homo sapiens (human)
G2/M transition of mitotic cell cycleWee1-like protein kinaseHomo sapiens (human)
microtubule cytoskeleton organizationWee1-like protein kinaseHomo sapiens (human)
negative regulation of G2/M transition of mitotic cell cycleWee1-like protein kinaseHomo sapiens (human)
establishment of cell polarityWee1-like protein kinaseHomo sapiens (human)
positive regulation of DNA replicationWee1-like protein kinaseHomo sapiens (human)
neuron projection morphogenesisWee1-like protein kinaseHomo sapiens (human)
cell divisionWee1-like protein kinaseHomo sapiens (human)
negative regulation of G1/S transition of mitotic cell cycleWee1-like protein kinaseHomo sapiens (human)
protein phosphorylationWee1-like protein kinaseHomo sapiens (human)
response to hypoxiaHeme oxygenase 2Homo sapiens (human)
response to oxidative stressHeme oxygenase 2Homo sapiens (human)
heme catabolic processHeme oxygenase 2Homo sapiens (human)
heme oxidationHeme oxygenase 2Homo sapiens (human)
S-adenosylmethionine biosynthetic processS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
one-carbon metabolic processS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
protein hexamerizationS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
protein heterooligomerizationS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
cellular response to methionineS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
positive regulation of TORC1 signalingS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
cellular response to leukemia inhibitory factorS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
protein foldingDnaJ homolog subfamily A member 1Homo sapiens (human)
response to unfolded proteinDnaJ homolog subfamily A member 1Homo sapiens (human)
spermatogenesisDnaJ homolog subfamily A member 1Homo sapiens (human)
response to heatDnaJ homolog subfamily A member 1Homo sapiens (human)
flagellated sperm motilityDnaJ homolog subfamily A member 1Homo sapiens (human)
androgen receptor signaling pathwayDnaJ homolog subfamily A member 1Homo sapiens (human)
negative regulation of protein ubiquitinationDnaJ homolog subfamily A member 1Homo sapiens (human)
positive regulation of apoptotic processDnaJ homolog subfamily A member 1Homo sapiens (human)
negative regulation of apoptotic processDnaJ homolog subfamily A member 1Homo sapiens (human)
negative regulation of JUN kinase activityDnaJ homolog subfamily A member 1Homo sapiens (human)
regulation of protein transportDnaJ homolog subfamily A member 1Homo sapiens (human)
protein localization to mitochondrionDnaJ homolog subfamily A member 1Homo sapiens (human)
negative regulation of establishment of protein localization to mitochondrionDnaJ homolog subfamily A member 1Homo sapiens (human)
negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathwayDnaJ homolog subfamily A member 1Homo sapiens (human)
protein refoldingDnaJ homolog subfamily A member 1Homo sapiens (human)
protein phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
activation-induced cell death of T cellsRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
intracellular signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
osteoblast differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
maternal placenta developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of endothelial cell proliferationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell migration involved in sprouting angiogenesisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
sphingosine-1-phosphate receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glycogen biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of glycogen biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glucose metabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of translationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein import into nucleusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nitric oxide biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
inflammatory responseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to oxidative stressRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
epidermal growth factor receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
G protein-coupled receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
canonical NF-kappaB signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell population proliferationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
insulin receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
apoptotic mitochondrial changesRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to heatRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
gene expressionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of autophagyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of endothelial cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of gene expressionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of gene expressionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of long-chain fatty acid import across plasma membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
fibroblast migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of fibroblast migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of sodium ion transportRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glucose metabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of endopeptidase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of neuron projection developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of macroautophagyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein ubiquitinationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
peptidyl-serine phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
peptidyl-threonine phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
virus-mediated perturbation of host defense responseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cytokine-mediated signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
mammalian oogenesis stageRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell growthRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
T cell costimulationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein ubiquitinationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of myelinationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
lipopolysaccharide-mediated signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
TOR signalingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of fatty acid beta-oxidationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of endodeoxyribonuclease activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to foodRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
peripheral nervous system myelin maintenanceRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to insulin stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to fluid shear stressRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to reactive oxygen speciesRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
interleukin-18-mediated signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to vascular endothelial growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to decreased oxygen levelsRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
non-canonical NF-kappaB signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glucose homeostasisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of apoptotic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of apoptotic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in apoptotic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
anoikisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of mRNA stabilityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphatidylinositol 3-kinase/protein kinase B signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of blood vessel endothelial cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of nitric oxide biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of fat cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glycogen biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cyclin-dependent protein serine/threonine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of Notch signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of proteolysisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of DNA-templated transcriptionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glucose importRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of organ growthRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein autophosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of lipid biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
insulin-like growth factor receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
behavioral response to painRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of smooth muscle cell proliferationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of nitric-oxide synthase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of DNA-binding transcription factor activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
striated muscle cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein metabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
excitatory postsynaptic potentialRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to growth hormoneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
mammary gland epithelial cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
labyrinthine layer blood vessel developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to UV-ARAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to growth factorRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to cadmium ionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to tumor necrosis factorRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to epidermal growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to prostaglandin E stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein serine/threonine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
establishment of protein localization to mitochondrionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
maintenance of protein location in mitochondrionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of release of cytochrome c from mitochondriaRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to granulocyte macrophage colony-stimulating factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
execution phase of apoptosisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of postsynapse organizationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of tRNA methylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to oxidised low-density lipoprotein particle stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein localization to lysosomeRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of cGAS/STING signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of G1/S transition of mitotic cell cycleRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to nucleusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to peptideRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of signal transduction by p53 class mediatorRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of cilium assemblyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of leukocyte cell-cell adhesionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to plasma membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of I-kappaB phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of TORC1 signalingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to endoplasmic reticulumRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to nerve growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to insulin-like growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to cell surfaceRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of type B pancreatic cell developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of lymphocyte migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathway in absence of ligandRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
intracellular signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glycogen biosynthetic processRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
glucose metabolic processRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
regulation of translationRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
signal transductionRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
insulin receptor signaling pathwayRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of long-chain fatty acid import across plasma membraneRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glucose metabolic processRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
regulation of cell migrationRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell migrationRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of fatty acid beta-oxidationRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
peripheral nervous system myelin maintenanceRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
cellular response to insulin stimulusRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
protein modification processRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
fat cell differentiationRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glycogen biosynthetic processRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glucose importRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
regulation of cell cycleRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
mammary gland epithelial cell differentiationRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
cellular response to high light intensityRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
organic substance transportRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
protein localization to plasma membraneRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein targeting to membraneRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
retinal rod cell apoptotic processRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell motilityRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
intracellular signal transductionRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
peptidyl-serine phosphorylationRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
long-chain fatty acid metabolic processCytochrome P450 2C19Homo sapiens (human)
xenobiotic metabolic processCytochrome P450 2C19Homo sapiens (human)
steroid metabolic processCytochrome P450 2C19Homo sapiens (human)
monoterpenoid metabolic processCytochrome P450 2C19Homo sapiens (human)
epoxygenase P450 pathwayCytochrome P450 2C19Homo sapiens (human)
xenobiotic catabolic processCytochrome P450 2C19Homo sapiens (human)
omega-hydroxylase P450 pathwayCytochrome P450 2C19Homo sapiens (human)
DNA replicationDNA replication licensing factor MCM4Homo sapiens (human)
DNA unwinding involved in DNA replicationDNA replication licensing factor MCM4Homo sapiens (human)
regulation of DNA-templated DNA replication initiationDNA replication licensing factor MCM4Homo sapiens (human)
double-strand break repair via break-induced replicationDNA replication licensing factor MCM4Homo sapiens (human)
DNA strand elongation involved in DNA replicationDNA replication licensing factor MCM4Homo sapiens (human)
mitotic DNA replication initiationDNA replication licensing factor MCM4Homo sapiens (human)
mitotic cytokinesisMyosin-10Homo sapiens (human)
actin filament-based movementMyosin-10Homo sapiens (human)
cell adhesionMyosin-10Homo sapiens (human)
actomyosin structure organizationMyosin-10Homo sapiens (human)
positive regulation of protein secretionMyosin-10Homo sapiens (human)
mitotic cytokinesisMyosin-10Homo sapiens (human)
regulation of cell shapeMyosin-10Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of protein phosphorylationVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of endothelial cell proliferationVascular endothelial growth factor receptor 3Homo sapiens (human)
vasculature developmentVascular endothelial growth factor receptor 3Homo sapiens (human)
lymph vessel developmentVascular endothelial growth factor receptor 3Homo sapiens (human)
lymphangiogenesisVascular endothelial growth factor receptor 3Homo sapiens (human)
sprouting angiogenesisVascular endothelial growth factor receptor 3Homo sapiens (human)
respiratory system processVascular endothelial growth factor receptor 3Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of cell population proliferationVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of vascular endothelial growth factor productionVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of endothelial cell migrationVascular endothelial growth factor receptor 3Homo sapiens (human)
peptidyl-tyrosine phosphorylationVascular endothelial growth factor receptor 3Homo sapiens (human)
cellular response to vascular endothelial growth factor stimulusVascular endothelial growth factor receptor 3Homo sapiens (human)
vascular endothelial growth factor signaling pathwayVascular endothelial growth factor receptor 3Homo sapiens (human)
negative regulation of apoptotic processVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of MAPK cascadeVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of JNK cascadeVascular endothelial growth factor receptor 3Homo sapiens (human)
protein autophosphorylationVascular endothelial growth factor receptor 3Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayVascular endothelial growth factor receptor 3Homo sapiens (human)
lung alveolus developmentVascular endothelial growth factor receptor 3Homo sapiens (human)
blood vessel morphogenesisVascular endothelial growth factor receptor 3Homo sapiens (human)
regulation of blood vessel remodelingVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of protein kinase C signalingVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of cell migrationVascular endothelial growth factor receptor 3Homo sapiens (human)
positive regulation of kinase activityVascular endothelial growth factor receptor 3Homo sapiens (human)
multicellular organism developmentVascular endothelial growth factor receptor 3Homo sapiens (human)
regulation of MAPK cascadeVascular endothelial growth factor receptor 3Homo sapiens (human)
angiogenesisVascular endothelial growth factor receptor 3Homo sapiens (human)
heart developmentDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
positive regulation of gene expressionDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
Schwann cell developmentDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
thyroid gland developmentDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
regulation of stress-activated MAPK cascadeDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
peptidyl-serine autophosphorylationDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
ERBB2-ERBB3 signaling pathwayDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
myelinationDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
positive regulation of DNA-templated transcriptionDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
thymus developmentDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
regulation of axon regenerationDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
positive regulation of axonogenesisDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
face developmentDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
trachea formationDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
epithelial cell proliferation involved in lung morphogenesisDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
ERK1 and ERK2 cascadeDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
positive regulation of protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
regulation of Golgi inheritanceDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
positive regulation of cell motilityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
regulation of early endosome to late endosome transportDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
hemopoiesisReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
leukocyte homeostasisReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
myeloid progenitor cell differentiationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
pro-B cell differentiationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
positive regulation of cell population proliferationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
response to organonitrogen compoundReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
peptidyl-tyrosine phosphorylationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
cytokine-mediated signaling pathwayReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
B cell differentiationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
animal organ regenerationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
common myeloid progenitor cell proliferationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
vascular endothelial growth factor signaling pathwayReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
positive regulation of tyrosine phosphorylation of STAT proteinReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
regulation of apoptotic processReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
positive regulation of MAP kinase activityReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
positive regulation of MAPK cascadeReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
lymphocyte proliferationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
protein autophosphorylationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
cellular response to cytokine stimulusReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
cellular response to glucocorticoid stimulusReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
dendritic cell differentiationReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
positive regulation of kinase activityReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
multicellular organism developmentReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
regulation of cardiac muscle cell apoptotic processBone morphogenetic protein receptor type-1AHomo sapiens (human)
regulation of neural crest cell differentiationBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of gene expressionBone morphogenetic protein receptor type-1AHomo sapiens (human)
negative regulation of gene expressionBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of transforming growth factor beta2 productionBone morphogenetic protein receptor type-1AHomo sapiens (human)
angiogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
osteoblast differentiationBone morphogenetic protein receptor type-1AHomo sapiens (human)
in utero embryonic developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
mesoderm formationBone morphogenetic protein receptor type-1AHomo sapiens (human)
somitogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
Mullerian duct regressionBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of mesenchymal cell proliferationBone morphogenetic protein receptor type-1AHomo sapiens (human)
chondrocyte differentiationBone morphogenetic protein receptor type-1AHomo sapiens (human)
outflow tract septum morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
outflow tract morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
cardiac conduction system developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
atrioventricular valve developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
mitral valve morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
tricuspid valve morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
endocardial cushion morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
cardiac right ventricle morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
ventricular trabecula myocardium morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
ventricular compact myocardium morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
endocardial cushion formationBone morphogenetic protein receptor type-1AHomo sapiens (human)
immune responseBone morphogenetic protein receptor type-1AHomo sapiens (human)
transforming growth factor beta receptor signaling pathwayBone morphogenetic protein receptor type-1AHomo sapiens (human)
ectoderm developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
dorsal/ventral axis specificationBone morphogenetic protein receptor type-1AHomo sapiens (human)
neural crest cell developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
negative regulation of smooth muscle cell migrationBone morphogenetic protein receptor type-1AHomo sapiens (human)
central nervous system neuron differentiationBone morphogenetic protein receptor type-1AHomo sapiens (human)
pituitary gland developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
neural plate mediolateral regionalizationBone morphogenetic protein receptor type-1AHomo sapiens (human)
lung developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of bone mineralizationBone morphogenetic protein receptor type-1AHomo sapiens (human)
BMP signaling pathwayBone morphogenetic protein receptor type-1AHomo sapiens (human)
somatic stem cell population maintenanceBone morphogenetic protein receptor type-1AHomo sapiens (human)
hindlimb morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
dorsal aorta morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
odontogenesis of dentin-containing toothBone morphogenetic protein receptor type-1AHomo sapiens (human)
embryonic digit morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of osteoblast differentiationBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIBone morphogenetic protein receptor type-1AHomo sapiens (human)
paraxial mesoderm structural organizationBone morphogenetic protein receptor type-1AHomo sapiens (human)
lateral mesoderm developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
regulation of lateral mesodermal cell fate specificationBone morphogenetic protein receptor type-1AHomo sapiens (human)
mesendoderm developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
embryonic organ developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
developmental growthBone morphogenetic protein receptor type-1AHomo sapiens (human)
epithelial cell proliferationBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of epithelial cell proliferationBone morphogenetic protein receptor type-1AHomo sapiens (human)
negative regulation of neurogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
negative regulation of muscle cell differentiationBone morphogenetic protein receptor type-1AHomo sapiens (human)
roof of mouth developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
regulation of cardiac muscle cell proliferationBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of cardiac muscle cell proliferationBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of SMAD protein signal transductionBone morphogenetic protein receptor type-1AHomo sapiens (human)
ventricular septum morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
heart formationBone morphogenetic protein receptor type-1AHomo sapiens (human)
atrioventricular node cell developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
pharyngeal arch artery morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
cellular response to BMP stimulusBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of miRNA transcriptionBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of cardiac ventricle developmentBone morphogenetic protein receptor type-1AHomo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationBone morphogenetic protein receptor type-1AHomo sapiens (human)
fibrous ring of heart morphogenesisBone morphogenetic protein receptor type-1AHomo sapiens (human)
regulation of cellular senescenceBone morphogenetic protein receptor type-1AHomo sapiens (human)
protein phosphorylationBone morphogenetic protein receptor type-1AHomo sapiens (human)
dorsal/ventral pattern formationBone morphogenetic protein receptor type-1AHomo sapiens (human)
cellular response to growth factor stimulusBone morphogenetic protein receptor type-1AHomo sapiens (human)
G1/S transition of mitotic cell cycleActivin receptor type-1BHomo sapiens (human)
in utero embryonic developmentActivin receptor type-1BHomo sapiens (human)
hair follicle developmentActivin receptor type-1BHomo sapiens (human)
regulation of DNA-templated transcriptionActivin receptor type-1BHomo sapiens (human)
signal transductionActivin receptor type-1BHomo sapiens (human)
cell surface receptor protein serine/threonine kinase signaling pathwayActivin receptor type-1BHomo sapiens (human)
positive regulation of gene expressionActivin receptor type-1BHomo sapiens (human)
negative regulation of gene expressionActivin receptor type-1BHomo sapiens (human)
peptidyl-threonine phosphorylationActivin receptor type-1BHomo sapiens (human)
negative regulation of cell growthActivin receptor type-1BHomo sapiens (human)
activin receptor signaling pathwayActivin receptor type-1BHomo sapiens (human)
positive regulation of activin receptor signaling pathwayActivin receptor type-1BHomo sapiens (human)
nodal signaling pathwayActivin receptor type-1BHomo sapiens (human)
positive regulation of erythrocyte differentiationActivin receptor type-1BHomo sapiens (human)
protein autophosphorylationActivin receptor type-1BHomo sapiens (human)
extrinsic apoptotic signaling pathwayActivin receptor type-1BHomo sapiens (human)
positive regulation of trophoblast cell migrationActivin receptor type-1BHomo sapiens (human)
cellular response to growth factor stimulusActivin receptor type-1BHomo sapiens (human)
protein phosphorylationActivin receptor type-1BHomo sapiens (human)
nervous system developmentActivin receptor type-1BHomo sapiens (human)
proepicardium developmentTGF-beta receptor type-1Homo sapiens (human)
negative regulation of cell migrationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of extracellular matrix assemblyTGF-beta receptor type-1Homo sapiens (human)
skeletal system developmentTGF-beta receptor type-1Homo sapiens (human)
in utero embryonic developmentTGF-beta receptor type-1Homo sapiens (human)
kidney developmentTGF-beta receptor type-1Homo sapiens (human)
blastocyst developmentTGF-beta receptor type-1Homo sapiens (human)
epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
endothelial cell proliferationTGF-beta receptor type-1Homo sapiens (human)
negative regulation of endothelial cell proliferationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of endothelial cell proliferationTGF-beta receptor type-1Homo sapiens (human)
lens development in camera-type eyeTGF-beta receptor type-1Homo sapiens (human)
ventricular trabecula myocardium morphogenesisTGF-beta receptor type-1Homo sapiens (human)
ventricular compact myocardium morphogenesisTGF-beta receptor type-1Homo sapiens (human)
regulation of DNA-templated transcriptionTGF-beta receptor type-1Homo sapiens (human)
apoptotic processTGF-beta receptor type-1Homo sapiens (human)
signal transductionTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta receptor signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
heart developmentTGF-beta receptor type-1Homo sapiens (human)
positive regulation of cell population proliferationTGF-beta receptor type-1Homo sapiens (human)
germ cell migrationTGF-beta receptor type-1Homo sapiens (human)
male gonad developmentTGF-beta receptor type-1Homo sapiens (human)
post-embryonic developmentTGF-beta receptor type-1Homo sapiens (human)
anterior/posterior pattern specificationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of gene expressionTGF-beta receptor type-1Homo sapiens (human)
regulation of epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
positive regulation of epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
peptidyl-serine phosphorylationTGF-beta receptor type-1Homo sapiens (human)
collagen fibril organizationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of cell growthTGF-beta receptor type-1Homo sapiens (human)
positive regulation of cell migrationTGF-beta receptor type-1Homo sapiens (human)
regulation of protein ubiquitinationTGF-beta receptor type-1Homo sapiens (human)
negative regulation of chondrocyte differentiationTGF-beta receptor type-1Homo sapiens (human)
activin receptor signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
intracellular signal transductionTGF-beta receptor type-1Homo sapiens (human)
myofibroblast differentiationTGF-beta receptor type-1Homo sapiens (human)
wound healingTGF-beta receptor type-1Homo sapiens (human)
endothelial cell activationTGF-beta receptor type-1Homo sapiens (human)
extracellular structure organizationTGF-beta receptor type-1Homo sapiens (human)
endothelial cell migrationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of DNA-templated transcriptionTGF-beta receptor type-1Homo sapiens (human)
filopodium assemblyTGF-beta receptor type-1Homo sapiens (human)
thymus developmentTGF-beta receptor type-1Homo sapiens (human)
neuron fate commitmentTGF-beta receptor type-1Homo sapiens (human)
embryonic cranial skeleton morphogenesisTGF-beta receptor type-1Homo sapiens (human)
skeletal system morphogenesisTGF-beta receptor type-1Homo sapiens (human)
mesenchymal cell differentiationTGF-beta receptor type-1Homo sapiens (human)
artery morphogenesisTGF-beta receptor type-1Homo sapiens (human)
cell motilityTGF-beta receptor type-1Homo sapiens (human)
positive regulation of filopodium assemblyTGF-beta receptor type-1Homo sapiens (human)
positive regulation of stress fiber assemblyTGF-beta receptor type-1Homo sapiens (human)
regulation of cell cycleTGF-beta receptor type-1Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionTGF-beta receptor type-1Homo sapiens (human)
parathyroid gland developmentTGF-beta receptor type-1Homo sapiens (human)
roof of mouth developmentTGF-beta receptor type-1Homo sapiens (human)
pharyngeal system developmentTGF-beta receptor type-1Homo sapiens (human)
regulation of cardiac muscle cell proliferationTGF-beta receptor type-1Homo sapiens (human)
cardiac epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
positive regulation of SMAD protein signal transductionTGF-beta receptor type-1Homo sapiens (human)
ventricular septum morphogenesisTGF-beta receptor type-1Homo sapiens (human)
angiogenesis involved in coronary vascular morphogenesisTGF-beta receptor type-1Homo sapiens (human)
coronary artery morphogenesisTGF-beta receptor type-1Homo sapiens (human)
response to cholesterolTGF-beta receptor type-1Homo sapiens (human)
cellular response to transforming growth factor beta stimulusTGF-beta receptor type-1Homo sapiens (human)
positive regulation of mesenchymal stem cell proliferationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of vasculature developmentTGF-beta receptor type-1Homo sapiens (human)
positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of tight junction disassemblyTGF-beta receptor type-1Homo sapiens (human)
epicardium morphogenesisTGF-beta receptor type-1Homo sapiens (human)
positive regulation of apoptotic signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
protein phosphorylationTGF-beta receptor type-1Homo sapiens (human)
cellular response to growth factor stimulusTGF-beta receptor type-1Homo sapiens (human)
nervous system developmentTGF-beta receptor type-1Homo sapiens (human)
cell proliferation involved in endocardial cushion morphogenesisTGF-beta receptor type-2Homo sapiens (human)
superior endocardial cushion morphogenesisTGF-beta receptor type-2Homo sapiens (human)
blood vessel developmentTGF-beta receptor type-2Homo sapiens (human)
branching involved in blood vessel morphogenesisTGF-beta receptor type-2Homo sapiens (human)
vasculogenesisTGF-beta receptor type-2Homo sapiens (human)
in utero embryonic developmentTGF-beta receptor type-2Homo sapiens (human)
epithelial to mesenchymal transitionTGF-beta receptor type-2Homo sapiens (human)
heart loopingTGF-beta receptor type-2Homo sapiens (human)
positive regulation of mesenchymal cell proliferationTGF-beta receptor type-2Homo sapiens (human)
lens development in camera-type eyeTGF-beta receptor type-2Homo sapiens (human)
positive regulation of tolerance induction to self antigenTGF-beta receptor type-2Homo sapiens (human)
positive regulation of B cell tolerance inductionTGF-beta receptor type-2Homo sapiens (human)
positive regulation of T cell tolerance inductionTGF-beta receptor type-2Homo sapiens (human)
outflow tract septum morphogenesisTGF-beta receptor type-2Homo sapiens (human)
membranous septum morphogenesisTGF-beta receptor type-2Homo sapiens (human)
outflow tract morphogenesisTGF-beta receptor type-2Homo sapiens (human)
aortic valve morphogenesisTGF-beta receptor type-2Homo sapiens (human)
atrioventricular valve morphogenesisTGF-beta receptor type-2Homo sapiens (human)
tricuspid valve morphogenesisTGF-beta receptor type-2Homo sapiens (human)
cardiac left ventricle morphogenesisTGF-beta receptor type-2Homo sapiens (human)
endocardial cushion fusionTGF-beta receptor type-2Homo sapiens (human)
growth plate cartilage chondrocyte growthTGF-beta receptor type-2Homo sapiens (human)
apoptotic processTGF-beta receptor type-2Homo sapiens (human)
transforming growth factor beta receptor signaling pathwayTGF-beta receptor type-2Homo sapiens (human)
Notch signaling pathwayTGF-beta receptor type-2Homo sapiens (human)
smoothened signaling pathwayTGF-beta receptor type-2Homo sapiens (human)
gastrulationTGF-beta receptor type-2Homo sapiens (human)
brain developmentTGF-beta receptor type-2Homo sapiens (human)
heart developmentTGF-beta receptor type-2Homo sapiens (human)
positive regulation of cell population proliferationTGF-beta receptor type-2Homo sapiens (human)
response to xenobiotic stimulusTGF-beta receptor type-2Homo sapiens (human)
regulation of gene expressionTGF-beta receptor type-2Homo sapiens (human)
positive regulation of epithelial cell migrationTGF-beta receptor type-2Homo sapiens (human)
positive regulation of epithelial to mesenchymal transitionTGF-beta receptor type-2Homo sapiens (human)
activation of protein kinase activityTGF-beta receptor type-2Homo sapiens (human)
activin receptor signaling pathwayTGF-beta receptor type-2Homo sapiens (human)
embryonic hemopoiesisTGF-beta receptor type-2Homo sapiens (human)
aorta morphogenesisTGF-beta receptor type-2Homo sapiens (human)
regulation of cell population proliferationTGF-beta receptor type-2Homo sapiens (human)
myeloid dendritic cell differentiationTGF-beta receptor type-2Homo sapiens (human)
positive regulation of angiogenesisTGF-beta receptor type-2Homo sapiens (human)
embryonic cranial skeleton morphogenesisTGF-beta receptor type-2Homo sapiens (human)
artery morphogenesisTGF-beta receptor type-2Homo sapiens (human)
positive regulation of NK T cell differentiationTGF-beta receptor type-2Homo sapiens (human)
roof of mouth developmentTGF-beta receptor type-2Homo sapiens (human)
positive regulation of SMAD protein signal transductionTGF-beta receptor type-2Homo sapiens (human)
SMAD protein signal transductionTGF-beta receptor type-2Homo sapiens (human)
ventricular septum morphogenesisTGF-beta receptor type-2Homo sapiens (human)
bronchus morphogenesisTGF-beta receptor type-2Homo sapiens (human)
trachea formationTGF-beta receptor type-2Homo sapiens (human)
mammary gland morphogenesisTGF-beta receptor type-2Homo sapiens (human)
lung lobe morphogenesisTGF-beta receptor type-2Homo sapiens (human)
Langerhans cell differentiationTGF-beta receptor type-2Homo sapiens (human)
secondary palate developmentTGF-beta receptor type-2Homo sapiens (human)
response to cholesterolTGF-beta receptor type-2Homo sapiens (human)
regulation of stem cell proliferationTGF-beta receptor type-2Homo sapiens (human)
positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formationTGF-beta receptor type-2Homo sapiens (human)
inferior endocardial cushion morphogenesisTGF-beta receptor type-2Homo sapiens (human)
lens fiber cell apoptotic processTGF-beta receptor type-2Homo sapiens (human)
miRNA transportTGF-beta receptor type-2Homo sapiens (human)
positive regulation of reactive oxygen species metabolic processTGF-beta receptor type-2Homo sapiens (human)
positive regulation of CD4-positive, alpha-beta T cell proliferationTGF-beta receptor type-2Homo sapiens (human)
regulation of stem cell differentiationTGF-beta receptor type-2Homo sapiens (human)
cellular response to growth factor stimulusTGF-beta receptor type-2Homo sapiens (human)
protein phosphorylationTGF-beta receptor type-2Homo sapiens (human)
amino acid catabolic processElectron transfer flavoprotein subunit betaHomo sapiens (human)
respiratory electron transport chainElectron transfer flavoprotein subunit betaHomo sapiens (human)
fatty acid beta-oxidation using acyl-CoA dehydrogenaseElectron transfer flavoprotein subunit betaHomo sapiens (human)
adaptive immune responseTyrosine-protein kinase CSKHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase CSKHomo sapiens (human)
negative regulation of cell population proliferationTyrosine-protein kinase CSKHomo sapiens (human)
negative regulation of low-density lipoprotein particle clearanceTyrosine-protein kinase CSKHomo sapiens (human)
T cell costimulationTyrosine-protein kinase CSKHomo sapiens (human)
negative regulation of interleukin-6 productionTyrosine-protein kinase CSKHomo sapiens (human)
negative regulation of Golgi to plasma membrane protein transportTyrosine-protein kinase CSKHomo sapiens (human)
negative regulation of bone resorptionTyrosine-protein kinase CSKHomo sapiens (human)
oligodendrocyte differentiationTyrosine-protein kinase CSKHomo sapiens (human)
negative regulation of phagocytosisTyrosine-protein kinase CSKHomo sapiens (human)
T cell receptor signaling pathwayTyrosine-protein kinase CSKHomo sapiens (human)
negative regulation of ERK1 and ERK2 cascadeTyrosine-protein kinase CSKHomo sapiens (human)
cellular response to peptide hormone stimulusTyrosine-protein kinase CSKHomo sapiens (human)
regulation of Fc receptor mediated stimulatory signaling pathwayTyrosine-protein kinase CSKHomo sapiens (human)
adherens junction organizationTyrosine-protein kinase CSKHomo sapiens (human)
tRNA aminoacylation for protein translationGlycine--tRNA ligaseHomo sapiens (human)
diadenosine tetraphosphate biosynthetic processGlycine--tRNA ligaseHomo sapiens (human)
mitochondrial glycyl-tRNA aminoacylationGlycine--tRNA ligaseHomo sapiens (human)
protein phosphorylationProtein kinase C iota typeHomo sapiens (human)
protein targeting to membraneProtein kinase C iota typeHomo sapiens (human)
cytoskeleton organizationProtein kinase C iota typeHomo sapiens (human)
actin filament organizationProtein kinase C iota typeHomo sapiens (human)
positive regulation of neuron projection developmentProtein kinase C iota typeHomo sapiens (human)
vesicle-mediated transportProtein kinase C iota typeHomo sapiens (human)
cell migrationProtein kinase C iota typeHomo sapiens (human)
cellular response to insulin stimulusProtein kinase C iota typeHomo sapiens (human)
negative regulation of glial cell apoptotic processProtein kinase C iota typeHomo sapiens (human)
establishment of apical/basal cell polarityProtein kinase C iota typeHomo sapiens (human)
eye photoreceptor cell developmentProtein kinase C iota typeHomo sapiens (human)
negative regulation of apoptotic processProtein kinase C iota typeHomo sapiens (human)
negative regulation of neuron apoptotic processProtein kinase C iota typeHomo sapiens (human)
establishment or maintenance of epithelial cell apical/basal polarityProtein kinase C iota typeHomo sapiens (human)
cell-cell junction organizationProtein kinase C iota typeHomo sapiens (human)
positive regulation of Notch signaling pathwayProtein kinase C iota typeHomo sapiens (human)
positive regulation of glucose importProtein kinase C iota typeHomo sapiens (human)
secretionProtein kinase C iota typeHomo sapiens (human)
Golgi vesicle buddingProtein kinase C iota typeHomo sapiens (human)
positive regulation of NF-kappaB transcription factor activityProtein kinase C iota typeHomo sapiens (human)
positive regulation of glial cell proliferationProtein kinase C iota typeHomo sapiens (human)
membrane organizationProtein kinase C iota typeHomo sapiens (human)
cellular response to chemical stressProtein kinase C iota typeHomo sapiens (human)
response to interleukin-1Protein kinase C iota typeHomo sapiens (human)
regulation of postsynaptic membrane neurotransmitter receptor levelsProtein kinase C iota typeHomo sapiens (human)
positive regulation of protein localization to plasma membraneProtein kinase C iota typeHomo sapiens (human)
positive regulation of endothelial cell apoptotic processProtein kinase C iota typeHomo sapiens (human)
intracellular signal transductionProtein kinase C iota typeHomo sapiens (human)
peptidyl-serine phosphorylationProtein kinase C iota typeHomo sapiens (human)
mRNA splicing, via spliceosomeExosome RNA helicase MTR4Homo sapiens (human)
maturation of 5.8S rRNAExosome RNA helicase MTR4Homo sapiens (human)
rRNA processingExosome RNA helicase MTR4Homo sapiens (human)
RNA catabolic processExosome RNA helicase MTR4Homo sapiens (human)
DNA damage responseExosome RNA helicase MTR4Homo sapiens (human)
snRNA catabolic processExosome RNA helicase MTR4Homo sapiens (human)
protein phosphorylationTyrosine-protein kinase TecHomo sapiens (human)
integrin-mediated signaling pathwayTyrosine-protein kinase TecHomo sapiens (human)
regulation of platelet activationTyrosine-protein kinase TecHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase TecHomo sapiens (human)
tissue regenerationTyrosine-protein kinase TecHomo sapiens (human)
B cell receptor signaling pathwayTyrosine-protein kinase TecHomo sapiens (human)
adaptive immune responseTyrosine-protein kinase TecHomo sapiens (human)
T cell receptor signaling pathwayTyrosine-protein kinase TecHomo sapiens (human)
positive regulation of cytosolic calcium ion concentrationTyrosine-protein kinase ABL2Homo sapiens (human)
positive regulation of phospholipase C activityTyrosine-protein kinase ABL2Homo sapiens (human)
negative regulation of Rho protein signal transductionTyrosine-protein kinase ABL2Homo sapiens (human)
exploration behaviorTyrosine-protein kinase ABL2Homo sapiens (human)
cell adhesionTyrosine-protein kinase ABL2Homo sapiens (human)
signal transductionTyrosine-protein kinase ABL2Homo sapiens (human)
regulation of autophagyTyrosine-protein kinase ABL2Homo sapiens (human)
positive regulation of neuron projection developmentTyrosine-protein kinase ABL2Homo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase ABL2Homo sapiens (human)
regulation of endocytosisTyrosine-protein kinase ABL2Homo sapiens (human)
regulation of cell adhesionTyrosine-protein kinase ABL2Homo sapiens (human)
regulation of actin cytoskeleton organizationTyrosine-protein kinase ABL2Homo sapiens (human)
protein modification processTyrosine-protein kinase ABL2Homo sapiens (human)
positive regulation of oxidoreductase activityTyrosine-protein kinase ABL2Homo sapiens (human)
cellular response to retinoic acidTyrosine-protein kinase ABL2Homo sapiens (human)
positive regulation of establishment of T cell polarityTyrosine-protein kinase ABL2Homo sapiens (human)
regulation of cell motilityTyrosine-protein kinase ABL2Homo sapiens (human)
positive regulation of T cell migrationTyrosine-protein kinase ABL2Homo sapiens (human)
epidermal growth factor receptor signaling pathwayTyrosine-protein kinase ABL2Homo sapiens (human)
protein phosphorylationTyrosine-protein kinase ABL2Homo sapiens (human)
negative regulation of transcription by RNA polymerase IITyrosine-protein kinase FRKHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase FRKHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase FRKHomo sapiens (human)
cell differentiationTyrosine-protein kinase FRKHomo sapiens (human)
innate immune responseTyrosine-protein kinase FRKHomo sapiens (human)
protein import into nucleusTyrosine-protein kinase SYKHomo sapiens (human)
regulation of DNA-binding transcription factor activityTyrosine-protein kinase SYKHomo sapiens (human)
angiogenesisTyrosine-protein kinase SYKHomo sapiens (human)
cell activationTyrosine-protein kinase SYKHomo sapiens (human)
lymph vessel developmentTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of receptor internalizationTyrosine-protein kinase SYKHomo sapiens (human)
stimulatory C-type lectin receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
adaptive immune responseTyrosine-protein kinase SYKHomo sapiens (human)
macrophage activation involved in immune responseTyrosine-protein kinase SYKHomo sapiens (human)
neutrophil activation involved in immune responseTyrosine-protein kinase SYKHomo sapiens (human)
leukocyte activation involved in immune responseTyrosine-protein kinase SYKHomo sapiens (human)
serotonin secretion by plateletTyrosine-protein kinase SYKHomo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusTyrosine-protein kinase SYKHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase SYKHomo sapiens (human)
leukocyte cell-cell adhesionTyrosine-protein kinase SYKHomo sapiens (human)
integrin-mediated signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
animal organ morphogenesisTyrosine-protein kinase SYKHomo sapiens (human)
regulation of platelet activationTyrosine-protein kinase SYKHomo sapiens (human)
regulation of tumor necrosis factor-mediated signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase SYKHomo sapiens (human)
leukotriene biosynthetic processTyrosine-protein kinase SYKHomo sapiens (human)
calcium-mediated signalingTyrosine-protein kinase SYKHomo sapiens (human)
platelet activationTyrosine-protein kinase SYKHomo sapiens (human)
B cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
neutrophil chemotaxisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of protein-containing complex assemblyTyrosine-protein kinase SYKHomo sapiens (human)
receptor internalizationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of type I interferon productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of granulocyte macrophage colony-stimulating factor productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-10 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-12 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-3 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-4 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-6 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-8 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of tumor necrosis factor productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of mast cell cytokine productionTyrosine-protein kinase SYKHomo sapiens (human)
regulation of superoxide anion generationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of superoxide anion generationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of cell adhesion mediated by integrinTyrosine-protein kinase SYKHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase SYKHomo sapiens (human)
collagen-activated tyrosine kinase receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
Fc-epsilon receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisTyrosine-protein kinase SYKHomo sapiens (human)
interleukin-3-mediated signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
gamma-delta T cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
defense response to bacteriumTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of cysteine-type endopeptidase activity involved in apoptotic processTyrosine-protein kinase SYKHomo sapiens (human)
mast cell degranulationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of mast cell degranulationTyrosine-protein kinase SYKHomo sapiens (human)
regulation of neutrophil degranulationTyrosine-protein kinase SYKHomo sapiens (human)
beta selectionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of MAPK cascadeTyrosine-protein kinase SYKHomo sapiens (human)
innate immune responseTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of B cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of gamma-delta T cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of bone resorptionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of alpha-beta T cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of alpha-beta T cell proliferationTyrosine-protein kinase SYKHomo sapiens (human)
blood vessel morphogenesisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationTyrosine-protein kinase SYKHomo sapiens (human)
regulation of phagocytosisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of calcium-mediated signalingTyrosine-protein kinase SYKHomo sapiens (human)
B cell receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of killing of cells of another organismTyrosine-protein kinase SYKHomo sapiens (human)
regulation of ERK1 and ERK2 cascadeTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to molecule of fungal originTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to lipidTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to low-density lipoprotein particle stimulusTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of monocyte chemotactic protein-1 productionTyrosine-protein kinase SYKHomo sapiens (human)
regulation of arachidonic acid secretionTyrosine-protein kinase SYKHomo sapiens (human)
regulation of platelet aggregationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of cold-induced thermogenesisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of TORC1 signalingTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to lectinTyrosine-protein kinase SYKHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
blastocyst development26S proteasome regulatory subunit 6BHomo sapiens (human)
proteolysis26S proteasome regulatory subunit 6BHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic process26S proteasome regulatory subunit 6BHomo sapiens (human)
positive regulation of proteasomal protein catabolic process26S proteasome regulatory subunit 6BHomo sapiens (human)
JUN phosphorylationMitogen-activated protein kinase 8Homo sapiens (human)
response to UVMitogen-activated protein kinase 8Homo sapiens (human)
negative regulation of apoptotic processMitogen-activated protein kinase 8Homo sapiens (human)
cellular response to lipopolysaccharideMitogen-activated protein kinase 8Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase 8Homo sapiens (human)
response to oxidative stressMitogen-activated protein kinase 8Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase 8Homo sapiens (human)
JUN phosphorylationMitogen-activated protein kinase 8Homo sapiens (human)
positive regulation of gene expressionMitogen-activated protein kinase 8Homo sapiens (human)
regulation of macroautophagyMitogen-activated protein kinase 8Homo sapiens (human)
peptidyl-serine phosphorylationMitogen-activated protein kinase 8Homo sapiens (human)
peptidyl-threonine phosphorylationMitogen-activated protein kinase 8Homo sapiens (human)
positive regulation of cyclase activityMitogen-activated protein kinase 8Homo sapiens (human)
positive regulation of cell killingMitogen-activated protein kinase 8Homo sapiens (human)
negative regulation of protein bindingMitogen-activated protein kinase 8Homo sapiens (human)
regulation of protein localizationMitogen-activated protein kinase 8Homo sapiens (human)
cellular response to amino acid starvationMitogen-activated protein kinase 8Homo sapiens (human)
cellular response to oxidative stressMitogen-activated protein kinase 8Homo sapiens (human)
cellular response to reactive oxygen speciesMitogen-activated protein kinase 8Homo sapiens (human)
Fc-epsilon receptor signaling pathwayMitogen-activated protein kinase 8Homo sapiens (human)
regulation of circadian rhythmMitogen-activated protein kinase 8Homo sapiens (human)
positive regulation of apoptotic processMitogen-activated protein kinase 8Homo sapiens (human)
negative regulation of apoptotic processMitogen-activated protein kinase 8Homo sapiens (human)
rhythmic processMitogen-activated protein kinase 8Homo sapiens (human)
positive regulation of protein metabolic processMitogen-activated protein kinase 8Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase 8Homo sapiens (human)
cellular response to mechanical stimulusMitogen-activated protein kinase 8Homo sapiens (human)
cellular response to cadmium ionMitogen-activated protein kinase 8Homo sapiens (human)
cellular senescenceMitogen-activated protein kinase 8Homo sapiens (human)
energy homeostasisMitogen-activated protein kinase 8Homo sapiens (human)
positive regulation of NLRP3 inflammasome complex assemblyMitogen-activated protein kinase 8Homo sapiens (human)
response to mechanical stimulusMitogen-activated protein kinase 8Homo sapiens (human)
positive regulation of establishment of protein localization to mitochondrionMitogen-activated protein kinase 8Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase 9Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of gene expressionMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of macrophage derived foam cell differentiationMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of protein ubiquitinationMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processMitogen-activated protein kinase 9Homo sapiens (human)
cellular response to reactive oxygen speciesMitogen-activated protein kinase 9Homo sapiens (human)
Fc-epsilon receptor signaling pathwayMitogen-activated protein kinase 9Homo sapiens (human)
regulation of circadian rhythmMitogen-activated protein kinase 9Homo sapiens (human)
rhythmic processMitogen-activated protein kinase 9Homo sapiens (human)
modulation of chemical synaptic transmissionMitogen-activated protein kinase 9Homo sapiens (human)
protein localization to tricellular tight junctionMitogen-activated protein kinase 9Homo sapiens (human)
cellular response to cadmium ionMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of podosome assemblyMitogen-activated protein kinase 9Homo sapiens (human)
cellular senescenceMitogen-activated protein kinase 9Homo sapiens (human)
inflammatory response to woundingMitogen-activated protein kinase 9Homo sapiens (human)
apoptotic signaling pathwayMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of cytokine production involved in inflammatory responseMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of apoptotic signaling pathwayMitogen-activated protein kinase 9Homo sapiens (human)
positive regulation of protein phosphorylationDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
JNK cascadeDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
response to woundingDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
smooth muscle cell apoptotic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to hydrogen peroxideDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
Fc-epsilon receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of neuron apoptotic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of DNA replicationDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of JNK cascadeDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of nitric-oxide synthase biosynthetic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cell growth involved in cardiac muscle cell developmentDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cellular response to mechanical stimulusDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cellular response to sorbitolDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cellular senescenceDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
negative regulation of motor neuron apoptotic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
regulation of cytokine productionDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
response to ischemiaDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
inflammatory responseDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
heart developmentDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
stress-activated protein kinase signaling cascadeDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
negative regulation of hippo signalingDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
cellular response to vascular endothelial growth factor stimulusDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
p38MAPK cascadeDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
positive regulation of MAPK cascadeDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
positive regulation of blood vessel endothelial cell migrationDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
positive regulation of protein kinase activityDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
positive regulation of DNA-templated transcriptionDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
positive regulation of nitric-oxide synthase biosynthetic processDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
cardiac muscle contractionDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
cellular response to lipopolysaccharideDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
cellular response to sorbitolDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
cellular senescenceDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
regulation of autophagyPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
megakaryocyte developmentPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
negative regulation of insulin receptor signaling pathwayPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
autophagosome-lysosome fusionPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
vesicle-mediated cholesterol transportPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic processPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
positive regulation of autophagosome assemblyPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
phosphatidylinositol phosphate biosynthetic processPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
protein phosphorylationCasein kinase I isoform alphaHomo sapiens (human)
Golgi organizationCasein kinase I isoform alphaHomo sapiens (human)
cell surface receptor signaling pathwayCasein kinase I isoform alphaHomo sapiens (human)
Wnt signaling pathwayCasein kinase I isoform alphaHomo sapiens (human)
peptidyl-serine phosphorylationCasein kinase I isoform alphaHomo sapiens (human)
viral protein processingCasein kinase I isoform alphaHomo sapiens (human)
cellular response to nutrientCasein kinase I isoform alphaHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processCasein kinase I isoform alphaHomo sapiens (human)
positive regulation of Rho protein signal transductionCasein kinase I isoform alphaHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processCasein kinase I isoform alphaHomo sapiens (human)
intermediate filament cytoskeleton organizationCasein kinase I isoform alphaHomo sapiens (human)
cell divisionCasein kinase I isoform alphaHomo sapiens (human)
negative regulation of canonical Wnt signaling pathwayCasein kinase I isoform alphaHomo sapiens (human)
negative regulation of NLRP3 inflammasome complex assemblyCasein kinase I isoform alphaHomo sapiens (human)
positive regulation of TORC1 signalingCasein kinase I isoform alphaHomo sapiens (human)
signal transductionCasein kinase I isoform alphaHomo sapiens (human)
microtubule nucleationCasein kinase I isoform deltaHomo sapiens (human)
Golgi organizationCasein kinase I isoform deltaHomo sapiens (human)
protein localization to Golgi apparatusCasein kinase I isoform deltaHomo sapiens (human)
protein localization to ciliumCasein kinase I isoform deltaHomo sapiens (human)
protein localization to centrosomeCasein kinase I isoform deltaHomo sapiens (human)
non-motile cilium assemblyCasein kinase I isoform deltaHomo sapiens (human)
positive regulation of protein phosphorylationCasein kinase I isoform deltaHomo sapiens (human)
protein phosphorylationCasein kinase I isoform deltaHomo sapiens (human)
Wnt signaling pathwayCasein kinase I isoform deltaHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processCasein kinase I isoform deltaHomo sapiens (human)
circadian regulation of gene expressionCasein kinase I isoform deltaHomo sapiens (human)
regulation of circadian rhythmCasein kinase I isoform deltaHomo sapiens (human)
COPII vesicle coatingCasein kinase I isoform deltaHomo sapiens (human)
spindle assemblyCasein kinase I isoform deltaHomo sapiens (human)
positive regulation of canonical Wnt signaling pathwayCasein kinase I isoform deltaHomo sapiens (human)
midbrain dopaminergic neuron differentiationCasein kinase I isoform deltaHomo sapiens (human)
cellular response to nerve growth factor stimulusCasein kinase I isoform deltaHomo sapiens (human)
positive regulation of non-canonical Wnt signaling pathwayCasein kinase I isoform deltaHomo sapiens (human)
peptidyl-serine phosphorylationCasein kinase I isoform deltaHomo sapiens (human)
signal transductionCasein kinase I isoform deltaHomo sapiens (human)
non-motile cilium assemblyCasein kinase I isoform deltaHomo sapiens (human)
endocytosisCasein kinase I isoform deltaHomo sapiens (human)
MAPK cascadeMAP kinase-activated protein kinase 2Homo sapiens (human)
toll-like receptor signaling pathwayMAP kinase-activated protein kinase 2Homo sapiens (human)
protein phosphorylationMAP kinase-activated protein kinase 2Homo sapiens (human)
leukotriene metabolic processMAP kinase-activated protein kinase 2Homo sapiens (human)
inflammatory responseMAP kinase-activated protein kinase 2Homo sapiens (human)
DNA damage responseMAP kinase-activated protein kinase 2Homo sapiens (human)
regulation of tumor necrosis factor-mediated signaling pathwayMAP kinase-activated protein kinase 2Homo sapiens (human)
peptidyl-serine phosphorylationMAP kinase-activated protein kinase 2Homo sapiens (human)
response to lipopolysaccharideMAP kinase-activated protein kinase 2Homo sapiens (human)
regulation of interleukin-6 productionMAP kinase-activated protein kinase 2Homo sapiens (human)
regulation of tumor necrosis factor productionMAP kinase-activated protein kinase 2Homo sapiens (human)
positive regulation of tumor necrosis factor productionMAP kinase-activated protein kinase 2Homo sapiens (human)
response to cytokineMAP kinase-activated protein kinase 2Homo sapiens (human)
cellular response to vascular endothelial growth factor stimulusMAP kinase-activated protein kinase 2Homo sapiens (human)
p38MAPK cascadeMAP kinase-activated protein kinase 2Homo sapiens (human)
regulation of mRNA stabilityMAP kinase-activated protein kinase 2Homo sapiens (human)
macropinocytosisMAP kinase-activated protein kinase 2Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayMAP kinase-activated protein kinase 2Homo sapiens (human)
inner ear developmentMAP kinase-activated protein kinase 2Homo sapiens (human)
positive regulation of macrophage cytokine productionMAP kinase-activated protein kinase 2Homo sapiens (human)
3'-UTR-mediated mRNA stabilizationMAP kinase-activated protein kinase 2Homo sapiens (human)
regulation of cellular response to heatMAP kinase-activated protein kinase 2Homo sapiens (human)
protein autophosphorylationMAP kinase-activated protein kinase 2Homo sapiens (human)
intracellular signal transductionMAP kinase-activated protein kinase 2Homo sapiens (human)
translational elongationElongation factor Tu, mitochondrialHomo sapiens (human)
response to ethanolElongation factor Tu, mitochondrialHomo sapiens (human)
mitochondrial translational elongationElongation factor Tu, mitochondrialHomo sapiens (human)
phosphatidylcholine biosynthetic processCholine-phosphate cytidylyltransferase AHomo sapiens (human)
CDP-choline pathwayCholine-phosphate cytidylyltransferase AHomo sapiens (human)
DNA repairCasein kinase I isoform epsilonHomo sapiens (human)
protein phosphorylationCasein kinase I isoform epsilonHomo sapiens (human)
protein localizationCasein kinase I isoform epsilonHomo sapiens (human)
negative regulation of Wnt signaling pathwayCasein kinase I isoform epsilonHomo sapiens (human)
negative regulation of protein bindingCasein kinase I isoform epsilonHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processCasein kinase I isoform epsilonHomo sapiens (human)
regulation of protein localizationCasein kinase I isoform epsilonHomo sapiens (human)
circadian regulation of gene expressionCasein kinase I isoform epsilonHomo sapiens (human)
regulation of circadian rhythmCasein kinase I isoform epsilonHomo sapiens (human)
circadian behaviorCasein kinase I isoform epsilonHomo sapiens (human)
canonical Wnt signaling pathwayCasein kinase I isoform epsilonHomo sapiens (human)
positive regulation of amyloid-beta formationCasein kinase I isoform epsilonHomo sapiens (human)
cellular response to nerve growth factor stimulusCasein kinase I isoform epsilonHomo sapiens (human)
positive regulation of non-canonical Wnt signaling pathwayCasein kinase I isoform epsilonHomo sapiens (human)
peptidyl-serine phosphorylationCasein kinase I isoform epsilonHomo sapiens (human)
endocytosisCasein kinase I isoform epsilonHomo sapiens (human)
positive regulation of canonical Wnt signaling pathwayCasein kinase I isoform epsilonHomo sapiens (human)
signal transductionCasein kinase I isoform epsilonHomo sapiens (human)
temperature homeostasisVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
response to coldVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
energy derivation by oxidation of organic compoundsVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
epithelial cell differentiationVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
fatty acid beta-oxidation using acyl-CoA dehydrogenaseVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
negative regulation of fatty acid biosynthetic processVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
negative regulation of fatty acid oxidationVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
regulation of cholesterol metabolic processVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
protein phosphorylationDual specificity protein kinase CLK2Homo sapiens (human)
response to ionizing radiationDual specificity protein kinase CLK2Homo sapiens (human)
regulation of RNA splicingDual specificity protein kinase CLK2Homo sapiens (human)
negative regulation of gluconeogenesisDual specificity protein kinase CLK2Homo sapiens (human)
protein autophosphorylationDual specificity protein kinase CLK2Homo sapiens (human)
peptidyl-tyrosine phosphorylationDual specificity protein kinase CLK2Homo sapiens (human)
regulation of systemic arterial blood pressureGlycogen synthase kinase-3 alphaHomo sapiens (human)
cardiac left ventricle morphogenesisGlycogen synthase kinase-3 alphaHomo sapiens (human)
glycogen metabolic processGlycogen synthase kinase-3 alphaHomo sapiens (human)
protein phosphorylationGlycogen synthase kinase-3 alphaHomo sapiens (human)
dopamine receptor signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
nervous system developmentGlycogen synthase kinase-3 alphaHomo sapiens (human)
insulin receptor signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of autophagyGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of gene expressionGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of peptidyl-threonine phosphorylationGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of UDP-glucose catabolic processGlycogen synthase kinase-3 alphaHomo sapiens (human)
Wnt signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
cell migrationGlycogen synthase kinase-3 alphaHomo sapiens (human)
peptidyl-threonine phosphorylationGlycogen synthase kinase-3 alphaHomo sapiens (human)
viral protein processingGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of protein ubiquitinationGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of TOR signalingGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processGlycogen synthase kinase-3 alphaHomo sapiens (human)
cellular response to insulin stimulusGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylationGlycogen synthase kinase-3 alphaHomo sapiens (human)
cellular response to interleukin-3Glycogen synthase kinase-3 alphaHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of glycogen biosynthetic processGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of protein catabolic processGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of heart contractionGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of glucose importGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of insulin receptor signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
excitatory postsynaptic potentialGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of cell growth involved in cardiac muscle cell developmentGlycogen synthase kinase-3 alphaHomo sapiens (human)
cellular response to lithium ionGlycogen synthase kinase-3 alphaHomo sapiens (human)
cellular response to glucocorticoid stimulusGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of canonical Wnt signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
extrinsic apoptotic signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
extrinsic apoptotic signaling pathway in absence of ligandGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
autosome genomic imprintingGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathwayGlycogen synthase kinase-3 alphaHomo sapiens (human)
regulation of mitophagyGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of amyloid-beta formationGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of protein targeting to mitochondrionGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of glycogen synthase activity, transferring glucose-1-phosphateGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of type B pancreatic cell developmentGlycogen synthase kinase-3 alphaHomo sapiens (human)
negative regulation of glycogen (starch) synthase activityGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of glycogen (starch) synthase activityGlycogen synthase kinase-3 alphaHomo sapiens (human)
cell differentiationGlycogen synthase kinase-3 alphaHomo sapiens (human)
regulation of microtubule cytoskeleton organizationGlycogen synthase kinase-3 alphaHomo sapiens (human)
regulation of neuron projection developmentGlycogen synthase kinase-3 alphaHomo sapiens (human)
positive regulation of gene expressionGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of gene expressionGlycogen synthase kinase-3 betaHomo sapiens (human)
ER overload responseGlycogen synthase kinase-3 betaHomo sapiens (human)
peptidyl-serine phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
intracellular signal transductionGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of apoptotic processGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein export from nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
epithelial to mesenchymal transitionGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of cell-matrix adhesionGlycogen synthase kinase-3 betaHomo sapiens (human)
glycogen metabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
protein phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
mitochondrion organizationGlycogen synthase kinase-3 betaHomo sapiens (human)
dopamine receptor signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
circadian rhythmGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of autophagyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of gene expressionGlycogen synthase kinase-3 betaHomo sapiens (human)
peptidyl-serine phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
peptidyl-threonine phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
viral protein processingGlycogen synthase kinase-3 betaHomo sapiens (human)
hippocampus developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
establishment of cell polarityGlycogen synthase kinase-3 betaHomo sapiens (human)
maintenance of cell polarityGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of cell migrationGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of axon extensionGlycogen synthase kinase-3 betaHomo sapiens (human)
neuron projection developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of protein-containing complex assemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein-containing complex assemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein ubiquitinationGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of phosphoprotein phosphatase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of microtubule-based processGlycogen synthase kinase-3 betaHomo sapiens (human)
intracellular signal transductionGlycogen synthase kinase-3 betaHomo sapiens (human)
cellular response to interleukin-3Glycogen synthase kinase-3 betaHomo sapiens (human)
regulation of circadian rhythmGlycogen synthase kinase-3 betaHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of GTPase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of cell differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of osteoblast differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of glycogen biosynthetic processGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of cilium assemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein catabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
protein autophosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of protein export from nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of dendrite morphogenesisGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of axonogenesisGlycogen synthase kinase-3 betaHomo sapiens (human)
canonical Wnt signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
excitatory postsynaptic potentialGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of microtubule cytoskeleton organizationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of calcineurin-NFAT signaling cascadeGlycogen synthase kinase-3 betaHomo sapiens (human)
superior temporal gyrus developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
cellular response to retinoic acidGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of canonical Wnt signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
extrinsic apoptotic signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
extrinsic apoptotic signaling pathway in absence of ligandGlycogen synthase kinase-3 betaHomo sapiens (human)
presynaptic modulation of chemical synaptic transmissionGlycogen synthase kinase-3 betaHomo sapiens (human)
neuron projection organizationGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of microtubule anchoring at centrosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of cellular response to heatGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of protein localization to nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of long-term synaptic potentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of protein acetylationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathway via death domain receptorsGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein localization to ciliumGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of dopaminergic neuron differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
cellular response to amyloid-betaGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein localization to centrosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
beta-catenin destruction complex disassemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of type B pancreatic cell developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of glycogen (starch) synthase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of mesenchymal stem cell differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of TOR signalingGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of neuron projection developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
cell differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
insulin receptor signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
DNA repairCyclin-dependent kinase 7Homo sapiens (human)
transcription by RNA polymerase IICyclin-dependent kinase 7Homo sapiens (human)
transcription initiation at RNA polymerase II promoterCyclin-dependent kinase 7Homo sapiens (human)
snRNA transcription by RNA polymerase IICyclin-dependent kinase 7Homo sapiens (human)
positive regulation of transcription by RNA polymerase IICyclin-dependent kinase 7Homo sapiens (human)
protein stabilizationCyclin-dependent kinase 7Homo sapiens (human)
cell divisionCyclin-dependent kinase 7Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 7Homo sapiens (human)
regulation of G1/S transition of mitotic cell cycleCyclin-dependent kinase 7Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 7Homo sapiens (human)
regulation of mitotic cell cycleCyclin-dependent kinase 9Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 9Homo sapiens (human)
DNA repairCyclin-dependent kinase 9Homo sapiens (human)
regulation of DNA repairCyclin-dependent kinase 9Homo sapiens (human)
transcription by RNA polymerase IICyclin-dependent kinase 9Homo sapiens (human)
transcription initiation at RNA polymerase II promoterCyclin-dependent kinase 9Homo sapiens (human)
transcription elongation by RNA polymerase IICyclin-dependent kinase 9Homo sapiens (human)
cell population proliferationCyclin-dependent kinase 9Homo sapiens (human)
replication fork processingCyclin-dependent kinase 9Homo sapiens (human)
regulation of mRNA 3'-end processingCyclin-dependent kinase 9Homo sapiens (human)
positive regulation of transcription elongation by RNA polymerase IICyclin-dependent kinase 9Homo sapiens (human)
positive regulation by host of viral transcriptionCyclin-dependent kinase 9Homo sapiens (human)
positive regulation of transcription by RNA polymerase IICyclin-dependent kinase 9Homo sapiens (human)
regulation of muscle cell differentiationCyclin-dependent kinase 9Homo sapiens (human)
nucleus localizationCyclin-dependent kinase 9Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 9Homo sapiens (human)
cellular response to cytokine stimulusCyclin-dependent kinase 9Homo sapiens (human)
negative regulation of protein localization to chromatinCyclin-dependent kinase 9Homo sapiens (human)
positive regulation of protein localization to chromatinCyclin-dependent kinase 9Homo sapiens (human)
transcription elongation-coupled chromatin remodelingCyclin-dependent kinase 9Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 9Homo sapiens (human)
exocytosisRas-related protein Rab-27AHomo sapiens (human)
blood coagulationRas-related protein Rab-27AHomo sapiens (human)
protein secretionRas-related protein Rab-27AHomo sapiens (human)
positive regulation of gene expressionRas-related protein Rab-27AHomo sapiens (human)
antigen processing and presentationRas-related protein Rab-27AHomo sapiens (human)
melanocyte differentiationRas-related protein Rab-27AHomo sapiens (human)
melanosome localizationRas-related protein Rab-27AHomo sapiens (human)
melanosome transportRas-related protein Rab-27AHomo sapiens (human)
multivesicular body organizationRas-related protein Rab-27AHomo sapiens (human)
cytotoxic T cell degranulationRas-related protein Rab-27AHomo sapiens (human)
natural killer cell degranulationRas-related protein Rab-27AHomo sapiens (human)
positive regulation of exocytosisRas-related protein Rab-27AHomo sapiens (human)
synaptic vesicle transportRas-related protein Rab-27AHomo sapiens (human)
positive regulation of phagocytosisRas-related protein Rab-27AHomo sapiens (human)
multivesicular body sorting pathwayRas-related protein Rab-27AHomo sapiens (human)
complement-dependent cytotoxicityRas-related protein Rab-27AHomo sapiens (human)
positive regulation of regulated secretory pathwayRas-related protein Rab-27AHomo sapiens (human)
positive regulation of reactive oxygen species biosynthetic processRas-related protein Rab-27AHomo sapiens (human)
positive regulation of constitutive secretory pathwayRas-related protein Rab-27AHomo sapiens (human)
exosomal secretionRas-related protein Rab-27AHomo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein autophosphorylationInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
regulation of cytokine-mediated signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
toll-like receptor signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
MyD88-dependent toll-like receptor signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
canonical NF-kappaB signal transductionInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
JNK cascadeInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
lipopolysaccharide-mediated signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
negative regulation of NF-kappaB transcription factor activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
positive regulation of type I interferon productionInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
response to lipopolysaccharideInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
toll-like receptor 2 signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
toll-like receptor 9 signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
cellular response to heatInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
interleukin-33-mediated signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein autophosphorylationInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
positive regulation of smooth muscle cell proliferationInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
type I interferon-mediated signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
interleukin-1-mediated signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
response to interleukin-1Interleukin-1 receptor-associated kinase 1Homo sapiens (human)
cellular response to hypoxiaInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
positive regulation of leukocyte adhesion to vascular endothelial cellInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
toll-like receptor 4 signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
positive regulation of MAP kinase activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
cellular response to lipopolysaccharideInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
intracellular signal transductionInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
Toll signaling pathwayInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
innate immune responseInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
skeletal system developmentRibosomal protein S6 kinase alpha-3Homo sapiens (human)
toll-like receptor signaling pathwayRibosomal protein S6 kinase alpha-3Homo sapiens (human)
signal transductionRibosomal protein S6 kinase alpha-3Homo sapiens (human)
chemical synaptic transmissionRibosomal protein S6 kinase alpha-3Homo sapiens (human)
central nervous system developmentRibosomal protein S6 kinase alpha-3Homo sapiens (human)
peptidyl-serine phosphorylationRibosomal protein S6 kinase alpha-3Homo sapiens (human)
positive regulation of cell growthRibosomal protein S6 kinase alpha-3Homo sapiens (human)
response to lipopolysaccharideRibosomal protein S6 kinase alpha-3Homo sapiens (human)
intracellular signal transductionRibosomal protein S6 kinase alpha-3Homo sapiens (human)
negative regulation of apoptotic processRibosomal protein S6 kinase alpha-3Homo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in apoptotic processRibosomal protein S6 kinase alpha-3Homo sapiens (human)
regulation of translation in response to stressRibosomal protein S6 kinase alpha-3Homo sapiens (human)
positive regulation of cell differentiationRibosomal protein S6 kinase alpha-3Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIRibosomal protein S6 kinase alpha-3Homo sapiens (human)
mitotic cell cycleSerine/threonine-protein kinase Nek2Homo sapiens (human)
blastocyst developmentSerine/threonine-protein kinase Nek2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase Nek2Homo sapiens (human)
chromosome segregationSerine/threonine-protein kinase Nek2Homo sapiens (human)
regulation of mitotic nuclear divisionSerine/threonine-protein kinase Nek2Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseSerine/threonine-protein kinase Nek2Homo sapiens (human)
regulation of mitotic centrosome separationSerine/threonine-protein kinase Nek2Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase Nek2Homo sapiens (human)
spindle assemblySerine/threonine-protein kinase Nek2Homo sapiens (human)
centrosome separationSerine/threonine-protein kinase Nek2Homo sapiens (human)
cell divisionSerine/threonine-protein kinase Nek2Homo sapiens (human)
meiotic cell cycleSerine/threonine-protein kinase Nek2Homo sapiens (human)
positive regulation of telomerase activitySerine/threonine-protein kinase Nek2Homo sapiens (human)
regulation of attachment of spindle microtubules to kinetochoreSerine/threonine-protein kinase Nek2Homo sapiens (human)
mitotic spindle assemblySerine/threonine-protein kinase Nek2Homo sapiens (human)
negative regulation of centriole-centriole cohesionSerine/threonine-protein kinase Nek2Homo sapiens (human)
positive regulation of telomere cappingSerine/threonine-protein kinase Nek2Homo sapiens (human)
mitotic cell cycleSerine/threonine-protein kinase Nek3Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase Nek3Homo sapiens (human)
establishment of cell polaritySerine/threonine-protein kinase Nek3Homo sapiens (human)
neuron projection morphogenesisSerine/threonine-protein kinase Nek3Homo sapiens (human)
cell divisionSerine/threonine-protein kinase Nek3Homo sapiens (human)
regulation of tubulin deacetylationSerine/threonine-protein kinase Nek3Homo sapiens (human)
adaptive immune responseTyrosine-protein kinase JAK3Homo sapiens (human)
negative regulation of dendritic cell cytokine productionTyrosine-protein kinase JAK3Homo sapiens (human)
protein phosphorylationTyrosine-protein kinase JAK3Homo sapiens (human)
enzyme-linked receptor protein signaling pathwayTyrosine-protein kinase JAK3Homo sapiens (human)
tyrosine phosphorylation of STAT proteinTyrosine-protein kinase JAK3Homo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase JAK3Homo sapiens (human)
B cell differentiationTyrosine-protein kinase JAK3Homo sapiens (human)
negative regulation of interleukin-10 productionTyrosine-protein kinase JAK3Homo sapiens (human)
negative regulation of interleukin-12 productionTyrosine-protein kinase JAK3Homo sapiens (human)
intracellular signal transductionTyrosine-protein kinase JAK3Homo sapiens (human)
interleukin-15-mediated signaling pathwayTyrosine-protein kinase JAK3Homo sapiens (human)
interleukin-4-mediated signaling pathwayTyrosine-protein kinase JAK3Homo sapiens (human)
interleukin-2-mediated signaling pathwayTyrosine-protein kinase JAK3Homo sapiens (human)
interleukin-9-mediated signaling pathwayTyrosine-protein kinase JAK3Homo sapiens (human)
T cell homeostasisTyrosine-protein kinase JAK3Homo sapiens (human)
innate immune responseTyrosine-protein kinase JAK3Homo sapiens (human)
negative regulation of FasL productionTyrosine-protein kinase JAK3Homo sapiens (human)
negative regulation of T-helper 1 cell differentiationTyrosine-protein kinase JAK3Homo sapiens (human)
regulation of receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK3Homo sapiens (human)
negative regulation of T cell activationTyrosine-protein kinase JAK3Homo sapiens (human)
growth hormone receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK3Homo sapiens (human)
regulation of T cell apoptotic processTyrosine-protein kinase JAK3Homo sapiens (human)
negative regulation of thymocyte apoptotic processTyrosine-protein kinase JAK3Homo sapiens (human)
response to interleukin-2Tyrosine-protein kinase JAK3Homo sapiens (human)
response to interleukin-4Tyrosine-protein kinase JAK3Homo sapiens (human)
response to interleukin-15Tyrosine-protein kinase JAK3Homo sapiens (human)
response to interleukin-9Tyrosine-protein kinase JAK3Homo sapiens (human)
regulation of apoptotic processTyrosine-protein kinase JAK3Homo sapiens (human)
cell differentiationTyrosine-protein kinase JAK3Homo sapiens (human)
cell surface receptor signaling pathway via JAK-STATTyrosine-protein kinase JAK3Homo sapiens (human)
cytokine-mediated signaling pathwayTyrosine-protein kinase JAK3Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
osteoblast differentiationDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
positive regulation of protein phosphorylationDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
response to ischemiaDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
apoptotic processDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
response to xenobiotic stimulusDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
ovulation cycle processDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
stress-activated protein kinase signaling cascadeDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
positive regulation of prostaglandin secretionDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
nucleotide-binding domain, leucine rich repeat containing receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
p38MAPK cascadeDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
signal transduction in response to DNA damageDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
positive regulation of apoptotic processDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
positive regulation of MAPK cascadeDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
stress-activated MAPK cascadeDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
regulation of cell cycleDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
positive regulation of nitric-oxide synthase biosynthetic processDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
cardiac muscle contractionDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
bone developmentDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
cellular response to sorbitolDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
cellular senescenceDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
negative regulation of cold-induced thermogenesisDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
regulation of signal transduction by p53 class mediatorDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
establishment of protein localizationSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic sister chromatid segregationSerine/threonine-protein kinase PLK1Homo sapiens (human)
G2/M transition of mitotic cell cycleSerine/threonine-protein kinase PLK1Homo sapiens (human)
negative regulation of transcription by RNA polymerase IISerine/threonine-protein kinase PLK1Homo sapiens (human)
establishment of mitotic spindle orientationSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic cell cycleSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic cytokinesisSerine/threonine-protein kinase PLK1Homo sapiens (human)
microtubule bundle formationSerine/threonine-protein kinase PLK1Homo sapiens (human)
double-strand break repairSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic spindle organizationSerine/threonine-protein kinase PLK1Homo sapiens (human)
sister chromatid cohesionSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic chromosome condensationSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic nuclear membrane disassemblySerine/threonine-protein kinase PLK1Homo sapiens (human)
metaphase/anaphase transition of mitotic cell cycleSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic spindle assembly checkpoint signalingSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic G2 DNA damage checkpoint signalingSerine/threonine-protein kinase PLK1Homo sapiens (human)
centrosome cycleSerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of mitotic cell cycleSerine/threonine-protein kinase PLK1Homo sapiens (human)
positive regulation of peptidyl-threonine phosphorylationSerine/threonine-protein kinase PLK1Homo sapiens (human)
female meiosis chromosome segregationSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein ubiquitinationSerine/threonine-protein kinase PLK1Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of mitotic metaphase/anaphase transitionSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein destabilizationSerine/threonine-protein kinase PLK1Homo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processSerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of cytokinesisSerine/threonine-protein kinase PLK1Homo sapiens (human)
negative regulation of apoptotic processSerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of protein bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
homologous chromosome segregationSerine/threonine-protein kinase PLK1Homo sapiens (human)
negative regulation of cyclin-dependent protein serine/threonine kinase activitySerine/threonine-protein kinase PLK1Homo sapiens (human)
positive regulation of proteolysisSerine/threonine-protein kinase PLK1Homo sapiens (human)
Golgi inheritanceSerine/threonine-protein kinase PLK1Homo sapiens (human)
nuclear membrane disassemblySerine/threonine-protein kinase PLK1Homo sapiens (human)
positive regulation of ubiquitin-protein transferase activitySerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of cell cycleSerine/threonine-protein kinase PLK1Homo sapiens (human)
synaptonemal complex disassemblySerine/threonine-protein kinase PLK1Homo sapiens (human)
protein localization to chromatinSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein localization to nuclear envelopeSerine/threonine-protein kinase PLK1Homo sapiens (human)
double-strand break repair via alternative nonhomologous end joiningSerine/threonine-protein kinase PLK1Homo sapiens (human)
positive regulation of protein localization to nucleusSerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of mitotic spindle assemblySerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of mitotic cell cycle phase transitionSerine/threonine-protein kinase PLK1Homo sapiens (human)
positive regulation of ubiquitin protein ligase activitySerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of protein localization to cell cortexSerine/threonine-protein kinase PLK1Homo sapiens (human)
regulation of anaphase-promoting complex-dependent catabolic processSerine/threonine-protein kinase PLK1Homo sapiens (human)
negative regulation of double-strand break repair via homologous recombinationSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein phosphorylationLIM domain kinase 1Homo sapiens (human)
signal transductionLIM domain kinase 1Homo sapiens (human)
Rho protein signal transductionLIM domain kinase 1Homo sapiens (human)
nervous system developmentLIM domain kinase 1Homo sapiens (human)
positive regulation of actin filament bundle assemblyLIM domain kinase 1Homo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisLIM domain kinase 1Homo sapiens (human)
stress fiber assemblyLIM domain kinase 1Homo sapiens (human)
positive regulation of axon extensionLIM domain kinase 1Homo sapiens (human)
axon extensionLIM domain kinase 1Homo sapiens (human)
negative regulation of ubiquitin-protein transferase activityLIM domain kinase 1Homo sapiens (human)
positive regulation of stress fiber assemblyLIM domain kinase 1Homo sapiens (human)
actin cytoskeleton organizationLIM domain kinase 1Homo sapiens (human)
positive regulation of protein phosphorylationLIM domain kinase 2Homo sapiens (human)
protein phosphorylationLIM domain kinase 2Homo sapiens (human)
spermatogenesisLIM domain kinase 2Homo sapiens (human)
phosphorylationLIM domain kinase 2Homo sapiens (human)
astral microtubule organizationLIM domain kinase 2Homo sapiens (human)
establishment of vesicle localizationLIM domain kinase 2Homo sapiens (human)
head developmentLIM domain kinase 2Homo sapiens (human)
cornea development in camera-type eyeLIM domain kinase 2Homo sapiens (human)
positive regulation of protein localization to nucleusLIM domain kinase 2Homo sapiens (human)
negative regulation of cilium assemblyLIM domain kinase 2Homo sapiens (human)
actin cytoskeleton organizationLIM domain kinase 2Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase 10Homo sapiens (human)
signal transductionMitogen-activated protein kinase 10Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase 10Homo sapiens (human)
response to light stimulusMitogen-activated protein kinase 10Homo sapiens (human)
Fc-epsilon receptor signaling pathwayMitogen-activated protein kinase 10Homo sapiens (human)
regulation of circadian rhythmMitogen-activated protein kinase 10Homo sapiens (human)
rhythmic processMitogen-activated protein kinase 10Homo sapiens (human)
cellular senescenceMitogen-activated protein kinase 10Homo sapiens (human)
tyrosyl-tRNA aminoacylationTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
apoptotic processTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
response to starvationTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
regulation of glycolytic process5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
protein phosphorylation5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
fatty acid biosynthetic process5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
signal transduction5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
spermatogenesis5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
positive regulation of gene expression5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
cellular response to nutrient levels5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
positive regulation of protein kinase activity5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
import into nucleus5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
regulation of catalytic activity5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
angiogenesisEphrin type-B receptor 3Homo sapiens (human)
urogenital system developmentEphrin type-B receptor 3Homo sapiens (human)
axon guidanceEphrin type-B receptor 3Homo sapiens (human)
axonal fasciculationEphrin type-B receptor 3Homo sapiens (human)
cell migrationEphrin type-B receptor 3Homo sapiens (human)
central nervous system projection neuron axonogenesisEphrin type-B receptor 3Homo sapiens (human)
corpus callosum developmentEphrin type-B receptor 3Homo sapiens (human)
regulation of cell-cell adhesionEphrin type-B receptor 3Homo sapiens (human)
retinal ganglion cell axon guidanceEphrin type-B receptor 3Homo sapiens (human)
substrate adhesion-dependent cell spreadingEphrin type-B receptor 3Homo sapiens (human)
regulation of GTPase activityEphrin type-B receptor 3Homo sapiens (human)
protein autophosphorylationEphrin type-B receptor 3Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-B receptor 3Homo sapiens (human)
thymus developmentEphrin type-B receptor 3Homo sapiens (human)
digestive tract morphogenesisEphrin type-B receptor 3Homo sapiens (human)
regulation of axonogenesisEphrin type-B receptor 3Homo sapiens (human)
positive regulation of synapse assemblyEphrin type-B receptor 3Homo sapiens (human)
roof of mouth developmentEphrin type-B receptor 3Homo sapiens (human)
dendritic spine developmentEphrin type-B receptor 3Homo sapiens (human)
dendritic spine morphogenesisEphrin type-B receptor 3Homo sapiens (human)
protein phosphorylationEphrin type-B receptor 3Homo sapiens (human)
axon guidanceEphrin type-A receptor 5Homo sapiens (human)
cAMP-mediated signalingEphrin type-A receptor 5Homo sapiens (human)
hippocampus developmentEphrin type-A receptor 5Homo sapiens (human)
positive regulation of CREB transcription factor activityEphrin type-A receptor 5Homo sapiens (human)
regulation of actin cytoskeleton organizationEphrin type-A receptor 5Homo sapiens (human)
regulation of GTPase activityEphrin type-A receptor 5Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-A receptor 5Homo sapiens (human)
neuron developmentEphrin type-A receptor 5Homo sapiens (human)
regulation of insulin secretion involved in cellular response to glucose stimulusEphrin type-A receptor 5Homo sapiens (human)
protein phosphorylationEphrin type-A receptor 5Homo sapiens (human)
angiogenesisEphrin type-B receptor 4Homo sapiens (human)
cell migration involved in sprouting angiogenesisEphrin type-B receptor 4Homo sapiens (human)
heart morphogenesisEphrin type-B receptor 4Homo sapiens (human)
cell adhesionEphrin type-B receptor 4Homo sapiens (human)
protein autophosphorylationEphrin type-B receptor 4Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-B receptor 4Homo sapiens (human)
multicellular organism developmentEphrin type-B receptor 4Homo sapiens (human)
positive regulation of kinase activityEphrin type-B receptor 4Homo sapiens (human)
negative regulation of cellular response to hypoxiaEphrin type-A receptor 4Homo sapiens (human)
cell adhesionEphrin type-A receptor 4Homo sapiens (human)
negative regulation of cell adhesionEphrin type-A receptor 4Homo sapiens (human)
adult walking behaviorEphrin type-A receptor 4Homo sapiens (human)
motor neuron axon guidanceEphrin type-A receptor 4Homo sapiens (human)
positive regulation of cell population proliferationEphrin type-A receptor 4Homo sapiens (human)
glial cell migrationEphrin type-A receptor 4Homo sapiens (human)
negative regulation of epithelial to mesenchymal transitionEphrin type-A receptor 4Homo sapiens (human)
negative regulation of neuron projection developmentEphrin type-A receptor 4Homo sapiens (human)
negative regulation of translationEphrin type-A receptor 4Homo sapiens (human)
peptidyl-tyrosine phosphorylationEphrin type-A receptor 4Homo sapiens (human)
corticospinal tract morphogenesisEphrin type-A receptor 4Homo sapiens (human)
positive regulation of cell migrationEphrin type-A receptor 4Homo sapiens (human)
negative regulation of cell migrationEphrin type-A receptor 4Homo sapiens (human)
adherens junction organizationEphrin type-A receptor 4Homo sapiens (human)
regulation of GTPase activityEphrin type-A receptor 4Homo sapiens (human)
positive regulation of cell adhesionEphrin type-A receptor 4Homo sapiens (human)
protein autophosphorylationEphrin type-A receptor 4Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-A receptor 4Homo sapiens (human)
negative regulation of axon regenerationEphrin type-A receptor 4Homo sapiens (human)
regulation of astrocyte differentiationEphrin type-A receptor 4Homo sapiens (human)
regulation of axonogenesisEphrin type-A receptor 4Homo sapiens (human)
positive regulation of dendrite morphogenesisEphrin type-A receptor 4Homo sapiens (human)
protein stabilizationEphrin type-A receptor 4Homo sapiens (human)
regulation of dendritic spine morphogenesisEphrin type-A receptor 4Homo sapiens (human)
positive regulation of protein tyrosine kinase activityEphrin type-A receptor 4Homo sapiens (human)
negative regulation of ERK1 and ERK2 cascadeEphrin type-A receptor 4Homo sapiens (human)
nephric duct morphogenesisEphrin type-A receptor 4Homo sapiens (human)
cochlea developmentEphrin type-A receptor 4Homo sapiens (human)
fasciculation of sensory neuron axonEphrin type-A receptor 4Homo sapiens (human)
fasciculation of motor neuron axonEphrin type-A receptor 4Homo sapiens (human)
neuron projection guidanceEphrin type-A receptor 4Homo sapiens (human)
synapse pruningEphrin type-A receptor 4Homo sapiens (human)
neuron projection fasciculationEphrin type-A receptor 4Homo sapiens (human)
negative regulation of long-term synaptic potentiationEphrin type-A receptor 4Homo sapiens (human)
positive regulation of amyloid-beta formationEphrin type-A receptor 4Homo sapiens (human)
positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic processEphrin type-A receptor 4Homo sapiens (human)
negative regulation of proteolysis involved in protein catabolic processEphrin type-A receptor 4Homo sapiens (human)
cellular response to amyloid-betaEphrin type-A receptor 4Homo sapiens (human)
regulation of modification of synaptic structureEphrin type-A receptor 4Homo sapiens (human)
regulation of synapse pruningEphrin type-A receptor 4Homo sapiens (human)
positive regulation of Rho guanyl-nucleotide exchange factor activityEphrin type-A receptor 4Homo sapiens (human)
protein phosphorylationEphrin type-A receptor 4Homo sapiens (human)
axon guidanceEphrin type-A receptor 4Homo sapiens (human)
ADP biosynthetic processAdenylate kinase 2, mitochondrialHomo sapiens (human)
nucleobase-containing small molecule interconversionAdenylate kinase 2, mitochondrialHomo sapiens (human)
AMP metabolic processAdenylate kinase 2, mitochondrialHomo sapiens (human)
ATP metabolic processAdenylate kinase 2, mitochondrialHomo sapiens (human)
nucleoside monophosphate phosphorylationAdenylate kinase 2, mitochondrialHomo sapiens (human)
purine ribonucleoside salvageAdenosine kinaseHomo sapiens (human)
dATP biosynthetic processAdenosine kinaseHomo sapiens (human)
ribonucleoside monophosphate biosynthetic processAdenosine kinaseHomo sapiens (human)
GMP salvageAdenosine kinaseHomo sapiens (human)
AMP salvageAdenosine kinaseHomo sapiens (human)
dAMP salvageAdenosine kinaseHomo sapiens (human)
purine nucleobase metabolic processAdenosine kinaseHomo sapiens (human)
Golgi to plasma membrane transportRas-related protein Rab-10Homo sapiens (human)
axonogenesisRas-related protein Rab-10Homo sapiens (human)
vesicle-mediated transportRas-related protein Rab-10Homo sapiens (human)
endosomal transportRas-related protein Rab-10Homo sapiens (human)
antigen processing and presentationRas-related protein Rab-10Homo sapiens (human)
polarized epithelial cell differentiationRas-related protein Rab-10Homo sapiens (human)
cellular response to insulin stimulusRas-related protein Rab-10Homo sapiens (human)
Golgi to plasma membrane protein transportRas-related protein Rab-10Homo sapiens (human)
regulated exocytosisRas-related protein Rab-10Homo sapiens (human)
establishment of neuroblast polarityRas-related protein Rab-10Homo sapiens (human)
endoplasmic reticulum tubular network organizationRas-related protein Rab-10Homo sapiens (human)
protein localization to plasma membraneRas-related protein Rab-10Homo sapiens (human)
establishment of protein localization to membraneRas-related protein Rab-10Homo sapiens (human)
establishment of protein localization to endoplasmic reticulum membraneRas-related protein Rab-10Homo sapiens (human)
cell-cell adhesionRas-related protein Rab-10Homo sapiens (human)
protein localization to basolateral plasma membraneRas-related protein Rab-10Homo sapiens (human)
exocytosisRas-related protein Rab-10Homo sapiens (human)
protein secretionRas-related protein Rab-10Homo sapiens (human)
establishment or maintenance of cell polarityActin-related protein 3Homo sapiens (human)
asymmetric cell divisionActin-related protein 3Homo sapiens (human)
positive regulation of lamellipodium assemblyActin-related protein 3Homo sapiens (human)
meiotic chromosome movement towards spindle poleActin-related protein 3Homo sapiens (human)
meiotic cytokinesisActin-related protein 3Homo sapiens (human)
Arp2/3 complex-mediated actin nucleationActin-related protein 3Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIActin-related protein 3Homo sapiens (human)
spindle localizationActin-related protein 3Homo sapiens (human)
cilium assemblyActin-related protein 3Homo sapiens (human)
actin polymerization-dependent cell motilityActin-related protein 3Homo sapiens (human)
cellular response to type II interferonActin-related protein 3Homo sapiens (human)
regulation of double-strand break repair via nonhomologous end joiningActin-related protein 2Homo sapiens (human)
cilium assemblyActin-related protein 2Homo sapiens (human)
establishment or maintenance of cell polarityActin-related protein 2Homo sapiens (human)
asymmetric cell divisionActin-related protein 2Homo sapiens (human)
positive regulation of lamellipodium assemblyActin-related protein 2Homo sapiens (human)
meiotic chromosome movement towards spindle poleActin-related protein 2Homo sapiens (human)
cytosolic transportActin-related protein 2Homo sapiens (human)
meiotic cytokinesisActin-related protein 2Homo sapiens (human)
Arp2/3 complex-mediated actin nucleationActin-related protein 2Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIActin-related protein 2Homo sapiens (human)
spindle localizationActin-related protein 2Homo sapiens (human)
cellular response to type II interferonActin-related protein 2Homo sapiens (human)
positive regulation of double-strand break repair via homologous recombinationActin-related protein 2Homo sapiens (human)
ribosomal large subunit export from nucleusGTP-binding nuclear protein RanHomo sapiens (human)
ribosomal small subunit export from nucleusGTP-binding nuclear protein RanHomo sapiens (human)
mitotic sister chromatid segregationGTP-binding nuclear protein RanHomo sapiens (human)
mitotic cell cycleGTP-binding nuclear protein RanHomo sapiens (human)
DNA metabolic processGTP-binding nuclear protein RanHomo sapiens (human)
protein import into nucleusGTP-binding nuclear protein RanHomo sapiens (human)
protein export from nucleusGTP-binding nuclear protein RanHomo sapiens (human)
mitotic spindle organizationGTP-binding nuclear protein RanHomo sapiens (human)
spermatid developmentGTP-binding nuclear protein RanHomo sapiens (human)
viral processGTP-binding nuclear protein RanHomo sapiens (human)
hippocampus developmentGTP-binding nuclear protein RanHomo sapiens (human)
actin cytoskeleton organizationGTP-binding nuclear protein RanHomo sapiens (human)
positive regulation of protein bindingGTP-binding nuclear protein RanHomo sapiens (human)
pre-miRNA export from nucleusGTP-binding nuclear protein RanHomo sapiens (human)
positive regulation of protein import into nucleusGTP-binding nuclear protein RanHomo sapiens (human)
GTP metabolic processGTP-binding nuclear protein RanHomo sapiens (human)
cell divisionGTP-binding nuclear protein RanHomo sapiens (human)
snRNA import into nucleusGTP-binding nuclear protein RanHomo sapiens (human)
cellular response to mineralocorticoid stimulusGTP-binding nuclear protein RanHomo sapiens (human)
protein localization to nucleolusGTP-binding nuclear protein RanHomo sapiens (human)
ribosomal subunit export from nucleusGTP-binding nuclear protein RanHomo sapiens (human)
positive regulation of lamellipodium assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
actin cytoskeleton organizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
ruffle organizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
neuron migrationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of protein phosphorylationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
sphingosine-1-phosphate receptor signaling pathwayRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
inflammatory responseRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cell adhesionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cell-matrix adhesionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
small GTPase-mediated signal transductionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of cell sizeRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
response to woundingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
anatomical structure morphogenesisRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of hydrogen peroxide metabolic processRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of lamellipodium assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of lamellipodium assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of endothelial cell migrationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
negative regulation of fibroblast migrationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of cell-substrate adhesionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cell migrationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
lamellipodium assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
actin filament polymerizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of cell migrationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of microtubule polymerizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
ruffle organizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
negative regulation of interleukin-23 productionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
substrate adhesion-dependent cell spreadingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of Rho protein signal transductionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
intracellular signal transductionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of nitric oxide biosynthetic processRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
respiratory burstRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
hepatocyte growth factor receptor signaling pathwayRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
negative regulation of receptor-mediated endocytosisRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cell motilityRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of stress fiber assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of stress fiber assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
localization within membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of focal adhesion assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
Wnt signaling pathway, planar cell polarity pathwayRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of respiratory burstRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
semaphorin-plexin signaling pathwayRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of neutrophil chemotaxisRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
ruffle assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
positive regulation of substrate adhesion-dependent cell spreadingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
engulfment of apoptotic cellRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cell projection assemblyRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cortical cytoskeleton organizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of neutrophil migrationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
establishment or maintenance of cell polarityRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of cell shapeRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
Rac protein signal transductionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
actin filament organizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
regulation of actin cytoskeleton organizationRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cell chemotaxisRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
motor neuron axon guidanceRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
protein phosphorylationCasein kinase I isoform gamma-2Homo sapiens (human)
Wnt signaling pathwayCasein kinase I isoform gamma-2Homo sapiens (human)
sphingolipid biosynthetic processCasein kinase I isoform gamma-2Homo sapiens (human)
signal transductionCasein kinase I isoform gamma-2Homo sapiens (human)
peptidyl-serine phosphorylationCasein kinase I isoform gamma-2Homo sapiens (human)
endocytosisCasein kinase I isoform gamma-2Homo sapiens (human)
positive regulation of canonical Wnt signaling pathwayCasein kinase I isoform gamma-2Homo sapiens (human)
DNA damage responseCyclin-dependent kinase 3Homo sapiens (human)
G1/S transition of mitotic cell cycleCyclin-dependent kinase 3Homo sapiens (human)
cell population proliferationCyclin-dependent kinase 3Homo sapiens (human)
G0 to G1 transitionCyclin-dependent kinase 3Homo sapiens (human)
negative regulation of Notch signaling pathwayCyclin-dependent kinase 3Homo sapiens (human)
cell divisionCyclin-dependent kinase 3Homo sapiens (human)
regulation of G2/M transition of mitotic cell cycleCyclin-dependent kinase 3Homo sapiens (human)
response to organic substanceCyclin-dependent kinase 3Homo sapiens (human)
signal transductionCyclin-dependent kinase 3Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 3Homo sapiens (human)
regulation of gene expressionCyclin-dependent kinase 3Homo sapiens (human)
G1/S transition of mitotic cell cycleCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of transcription by RNA polymerase IICyclin-dependent kinase 6Homo sapiens (human)
positive regulation of cell-matrix adhesionCyclin-dependent kinase 6Homo sapiens (human)
type B pancreatic cell developmentCyclin-dependent kinase 6Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 6Homo sapiens (human)
Notch signaling pathwayCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of cell population proliferationCyclin-dependent kinase 6Homo sapiens (human)
response to virusCyclin-dependent kinase 6Homo sapiens (human)
regulation of gene expressionCyclin-dependent kinase 6Homo sapiens (human)
positive regulation of gene expressionCyclin-dependent kinase 6Homo sapiens (human)
astrocyte developmentCyclin-dependent kinase 6Homo sapiens (human)
dentate gyrus developmentCyclin-dependent kinase 6Homo sapiens (human)
lateral ventricle developmentCyclin-dependent kinase 6Homo sapiens (human)
T cell differentiation in thymusCyclin-dependent kinase 6Homo sapiens (human)
gliogenesisCyclin-dependent kinase 6Homo sapiens (human)
cell dedifferentiationCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of cell differentiationCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of myeloid cell differentiationCyclin-dependent kinase 6Homo sapiens (human)
regulation of erythrocyte differentiationCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of monocyte differentiationCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of osteoblast differentiationCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of cell cycleCyclin-dependent kinase 6Homo sapiens (human)
positive regulation of fibroblast proliferationCyclin-dependent kinase 6Homo sapiens (human)
generation of neuronsCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of epithelial cell proliferationCyclin-dependent kinase 6Homo sapiens (human)
cell divisionCyclin-dependent kinase 6Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 6Homo sapiens (human)
hematopoietic stem cell differentiationCyclin-dependent kinase 6Homo sapiens (human)
regulation of hematopoietic stem cell differentiationCyclin-dependent kinase 6Homo sapiens (human)
regulation of cell motilityCyclin-dependent kinase 6Homo sapiens (human)
negative regulation of cellular senescenceCyclin-dependent kinase 6Homo sapiens (human)
regulation of G2/M transition of mitotic cell cycleCyclin-dependent kinase 6Homo sapiens (human)
response to organic substanceCyclin-dependent kinase 6Homo sapiens (human)
signal transductionCyclin-dependent kinase 6Homo sapiens (human)
microtubule cytoskeleton organizationCyclin-dependent-like kinase 5 Homo sapiens (human)
neuron migrationCyclin-dependent-like kinase 5 Homo sapiens (human)
synaptic transmission, dopaminergicCyclin-dependent-like kinase 5 Homo sapiens (human)
protein phosphorylationCyclin-dependent-like kinase 5 Homo sapiens (human)
intracellular protein transportCyclin-dependent-like kinase 5 Homo sapiens (human)
cell-matrix adhesionCyclin-dependent-like kinase 5 Homo sapiens (human)
chemical synaptic transmissionCyclin-dependent-like kinase 5 Homo sapiens (human)
synapse assemblyCyclin-dependent-like kinase 5 Homo sapiens (human)
skeletal muscle tissue developmentCyclin-dependent-like kinase 5 Homo sapiens (human)
motor neuron axon guidanceCyclin-dependent-like kinase 5 Homo sapiens (human)
visual learningCyclin-dependent-like kinase 5 Homo sapiens (human)
Schwann cell developmentCyclin-dependent-like kinase 5 Homo sapiens (human)
synaptic vesicle exocytosisCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of macroautophagyCyclin-dependent-like kinase 5 Homo sapiens (human)
phosphorylationCyclin-dependent-like kinase 5 Homo sapiens (human)
peptidyl-serine phosphorylationCyclin-dependent-like kinase 5 Homo sapiens (human)
peptidyl-threonine phosphorylationCyclin-dependent-like kinase 5 Homo sapiens (human)
sensory perception of painCyclin-dependent-like kinase 5 Homo sapiens (human)
cerebellar cortex formationCyclin-dependent-like kinase 5 Homo sapiens (human)
hippocampus developmentCyclin-dependent-like kinase 5 Homo sapiens (human)
layer formation in cerebral cortexCyclin-dependent-like kinase 5 Homo sapiens (human)
central nervous system neuron developmentCyclin-dependent-like kinase 5 Homo sapiens (human)
corpus callosum developmentCyclin-dependent-like kinase 5 Homo sapiens (human)
neuron differentiationCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of cell migrationCyclin-dependent-like kinase 5 Homo sapiens (human)
negative regulation of axon extensionCyclin-dependent-like kinase 5 Homo sapiens (human)
neuron projection developmentCyclin-dependent-like kinase 5 Homo sapiens (human)
negative regulation of protein ubiquitinationCyclin-dependent-like kinase 5 Homo sapiens (human)
negative regulation of synaptic plasticityCyclin-dependent-like kinase 5 Homo sapiens (human)
receptor catabolic processCyclin-dependent-like kinase 5 Homo sapiens (human)
synaptic transmission, glutamatergicCyclin-dependent-like kinase 5 Homo sapiens (human)
protein localization to synapseCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of apoptotic processCyclin-dependent-like kinase 5 Homo sapiens (human)
receptor clusteringCyclin-dependent-like kinase 5 Homo sapiens (human)
positive regulation of neuron apoptotic processCyclin-dependent-like kinase 5 Homo sapiens (human)
negative regulation of cell cycleCyclin-dependent-like kinase 5 Homo sapiens (human)
negative regulation of proteolysisCyclin-dependent-like kinase 5 Homo sapiens (human)
negative regulation of DNA-templated transcriptionCyclin-dependent-like kinase 5 Homo sapiens (human)
positive regulation of calcium ion-dependent exocytosisCyclin-dependent-like kinase 5 Homo sapiens (human)
negative regulation of protein export from nucleusCyclin-dependent-like kinase 5 Homo sapiens (human)
behavioral response to cocaineCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of synaptic plasticityCyclin-dependent-like kinase 5 Homo sapiens (human)
synaptic vesicle endocytosisCyclin-dependent-like kinase 5 Homo sapiens (human)
rhythmic processCyclin-dependent-like kinase 5 Homo sapiens (human)
axon extensionCyclin-dependent-like kinase 5 Homo sapiens (human)
oligodendrocyte differentiationCyclin-dependent-like kinase 5 Homo sapiens (human)
dendrite morphogenesisCyclin-dependent-like kinase 5 Homo sapiens (human)
cell divisionCyclin-dependent-like kinase 5 Homo sapiens (human)
neuron apoptotic processCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of cell cycleCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of synaptic transmission, glutamatergicCyclin-dependent-like kinase 5 Homo sapiens (human)
excitatory postsynaptic potentialCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of dendritic spine morphogenesisCyclin-dependent-like kinase 5 Homo sapiens (human)
calcium ion importCyclin-dependent-like kinase 5 Homo sapiens (human)
positive regulation of protein targeting to membraneCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of protein localization to plasma membraneCyclin-dependent-like kinase 5 Homo sapiens (human)
regulation of synaptic vesicle recyclingCyclin-dependent-like kinase 5 Homo sapiens (human)
cellular response to amyloid-betaCyclin-dependent-like kinase 5 Homo sapiens (human)
axonogenesisCyclin-dependent-like kinase 5 Homo sapiens (human)
synaptic vesicle transportCyclin-dependent-like kinase 5 Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 16Homo sapiens (human)
exocytosisCyclin-dependent kinase 16Homo sapiens (human)
spermatogenesisCyclin-dependent kinase 16Homo sapiens (human)
positive regulation of autophagyCyclin-dependent kinase 16Homo sapiens (human)
growth hormone secretionCyclin-dependent kinase 16Homo sapiens (human)
neuron projection developmentCyclin-dependent kinase 16Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 16Homo sapiens (human)
regulation of insulin secretion involved in cellular response to glucose stimulusCyclin-dependent kinase 16Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 17Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 17Homo sapiens (human)
cellular response to leukemia inhibitory factorATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
canonical glycolysisATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
fructose 1,6-bisphosphate metabolic processATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
fructose 6-phosphate metabolic processATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
chemotaxisDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
heart developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
negative regulation of cell population proliferationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of gene expressionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
Schwann cell developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cerebellar cortex formationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
keratinocyte differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
thyroid gland developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of stress-activated MAPK cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
endodermal cell differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
ERBB2-ERBB3 signaling pathwayDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
myelinationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
type B pancreatic cell proliferationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of DNA-templated transcriptionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
thymus developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of axon regenerationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cell motilityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of axonogenesisDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
Bergmann glial cell differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
face developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
trachea formationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
epithelial cell proliferation involved in lung morphogenesisDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
placenta blood vessel developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
labyrinthine layer developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
ERK1 and ERK2 cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of Golgi inheritanceDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cellular senescenceDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of endodermal cell differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of early endosome to late endosome transportDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
neuron differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
neuron migrationDNA topoisomerase 2-betaHomo sapiens (human)
DNA topological changeDNA topoisomerase 2-betaHomo sapiens (human)
axonogenesisDNA topoisomerase 2-betaHomo sapiens (human)
B cell differentiationDNA topoisomerase 2-betaHomo sapiens (human)
forebrain developmentDNA topoisomerase 2-betaHomo sapiens (human)
positive regulation of single stranded viral RNA replication via double stranded DNA intermediateDNA topoisomerase 2-betaHomo sapiens (human)
cellular response to hydrogen peroxideDNA topoisomerase 2-betaHomo sapiens (human)
cellular response to ATPDNA topoisomerase 2-betaHomo sapiens (human)
cellular senescenceDNA topoisomerase 2-betaHomo sapiens (human)
positive regulation of double-strand break repair via nonhomologous end joiningDNA topoisomerase 2-betaHomo sapiens (human)
sister chromatid segregationDNA topoisomerase 2-betaHomo sapiens (human)
resolution of meiotic recombination intermediatesDNA topoisomerase 2-betaHomo sapiens (human)
regulation of cell growthProtein kinase C theta typeHomo sapiens (human)
regulation of DNA-templated transcriptionProtein kinase C theta typeHomo sapiens (human)
protein phosphorylationProtein kinase C theta typeHomo sapiens (human)
membrane protein ectodomain proteolysisProtein kinase C theta typeHomo sapiens (human)
inflammatory responseProtein kinase C theta typeHomo sapiens (human)
axon guidanceProtein kinase C theta typeHomo sapiens (human)
positive regulation of telomere maintenance via telomeraseProtein kinase C theta typeHomo sapiens (human)
positive regulation of interleukin-17 productionProtein kinase C theta typeHomo sapiens (human)
positive regulation of interleukin-2 productionProtein kinase C theta typeHomo sapiens (human)
positive regulation of interleukin-4 productionProtein kinase C theta typeHomo sapiens (human)
intracellular signal transductionProtein kinase C theta typeHomo sapiens (human)
CD4-positive, alpha-beta T cell proliferationProtein kinase C theta typeHomo sapiens (human)
Fc-epsilon receptor signaling pathwayProtein kinase C theta typeHomo sapiens (human)
negative regulation of insulin receptor signaling pathwayProtein kinase C theta typeHomo sapiens (human)
positive regulation of T cell activationProtein kinase C theta typeHomo sapiens (human)
positive regulation of NF-kappaB transcription factor activityProtein kinase C theta typeHomo sapiens (human)
positive regulation of telomerase activityProtein kinase C theta typeHomo sapiens (human)
cell chemotaxisProtein kinase C theta typeHomo sapiens (human)
negative regulation of T cell apoptotic processProtein kinase C theta typeHomo sapiens (human)
regulation of platelet aggregationProtein kinase C theta typeHomo sapiens (human)
positive regulation of telomere cappingProtein kinase C theta typeHomo sapiens (human)
positive regulation of T-helper 17 type immune responseProtein kinase C theta typeHomo sapiens (human)
positive regulation of CD4-positive, alpha-beta T cell proliferationProtein kinase C theta typeHomo sapiens (human)
positive regulation of T-helper 2 cell activationProtein kinase C theta typeHomo sapiens (human)
peptidyl-serine phosphorylationProtein kinase C theta typeHomo sapiens (human)
outflow tract septum morphogenesisActivin receptor type-1Homo sapiens (human)
branching involved in blood vessel morphogenesisActivin receptor type-1Homo sapiens (human)
in utero embryonic developmentActivin receptor type-1Homo sapiens (human)
gastrulation with mouth forming secondActivin receptor type-1Homo sapiens (human)
mesoderm formationActivin receptor type-1Homo sapiens (human)
neural crest cell migrationActivin receptor type-1Homo sapiens (human)
acute inflammatory responseActivin receptor type-1Homo sapiens (human)
embryonic heart tube morphogenesisActivin receptor type-1Homo sapiens (human)
atrioventricular valve morphogenesisActivin receptor type-1Homo sapiens (human)
mitral valve morphogenesisActivin receptor type-1Homo sapiens (human)
endocardial cushion formationActivin receptor type-1Homo sapiens (human)
endocardial cushion fusionActivin receptor type-1Homo sapiens (human)
atrial septum primum morphogenesisActivin receptor type-1Homo sapiens (human)
transforming growth factor beta receptor signaling pathwayActivin receptor type-1Homo sapiens (human)
germ cell developmentActivin receptor type-1Homo sapiens (human)
determination of left/right symmetryActivin receptor type-1Homo sapiens (human)
negative regulation of signal transductionActivin receptor type-1Homo sapiens (human)
regulation of ossificationActivin receptor type-1Homo sapiens (human)
positive regulation of cell migrationActivin receptor type-1Homo sapiens (human)
positive regulation of bone mineralizationActivin receptor type-1Homo sapiens (human)
BMP signaling pathwayActivin receptor type-1Homo sapiens (human)
activin receptor signaling pathwayActivin receptor type-1Homo sapiens (human)
negative regulation of activin receptor signaling pathwayActivin receptor type-1Homo sapiens (human)
positive regulation of osteoblast differentiationActivin receptor type-1Homo sapiens (human)
positive regulation of DNA-templated transcriptionActivin receptor type-1Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIActivin receptor type-1Homo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationActivin receptor type-1Homo sapiens (human)
smooth muscle cell differentiationActivin receptor type-1Homo sapiens (human)
pharyngeal system developmentActivin receptor type-1Homo sapiens (human)
positive regulation of SMAD protein signal transductionActivin receptor type-1Homo sapiens (human)
ventricular septum morphogenesisActivin receptor type-1Homo sapiens (human)
cardiac muscle cell fate commitmentActivin receptor type-1Homo sapiens (human)
endocardial cushion cell fate commitmentActivin receptor type-1Homo sapiens (human)
positive regulation of cardiac epithelial to mesenchymal transitionActivin receptor type-1Homo sapiens (human)
cellular response to BMP stimulusActivin receptor type-1Homo sapiens (human)
positive regulation of determination of dorsal identityActivin receptor type-1Homo sapiens (human)
negative regulation of G1/S transition of mitotic cell cycleActivin receptor type-1Homo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathwayActivin receptor type-1Homo sapiens (human)
dorsal/ventral pattern formationActivin receptor type-1Homo sapiens (human)
heart developmentActivin receptor type-1Homo sapiens (human)
protein phosphorylationActivin receptor type-1Homo sapiens (human)
cellular response to growth factor stimulusActivin receptor type-1Homo sapiens (human)
defense responseMacrophage-stimulating protein receptorHomo sapiens (human)
signal transductionMacrophage-stimulating protein receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayMacrophage-stimulating protein receptorHomo sapiens (human)
single fertilizationMacrophage-stimulating protein receptorHomo sapiens (human)
positive regulation of cell population proliferationMacrophage-stimulating protein receptorHomo sapiens (human)
response to virusMacrophage-stimulating protein receptorHomo sapiens (human)
macrophage colony-stimulating factor signaling pathwayMacrophage-stimulating protein receptorHomo sapiens (human)
positive regulation of MAP kinase activityMacrophage-stimulating protein receptorHomo sapiens (human)
innate immune responseMacrophage-stimulating protein receptorHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionMacrophage-stimulating protein receptorHomo sapiens (human)
nervous system developmentMacrophage-stimulating protein receptorHomo sapiens (human)
cell migrationMacrophage-stimulating protein receptorHomo sapiens (human)
phagocytosisMacrophage-stimulating protein receptorHomo sapiens (human)
positive regulation of kinase activityMacrophage-stimulating protein receptorHomo sapiens (human)
multicellular organism developmentMacrophage-stimulating protein receptorHomo sapiens (human)
positive regulation of macrophage chemotaxisFocal adhesion kinase 1Homo sapiens (human)
positive regulation of macrophage proliferationFocal adhesion kinase 1Homo sapiens (human)
angiogenesisFocal adhesion kinase 1Homo sapiens (human)
placenta developmentFocal adhesion kinase 1Homo sapiens (human)
regulation of protein phosphorylationFocal adhesion kinase 1Homo sapiens (human)
positive regulation of protein phosphorylationFocal adhesion kinase 1Homo sapiens (human)
heart morphogenesisFocal adhesion kinase 1Homo sapiens (human)
signal complex assemblyFocal adhesion kinase 1Homo sapiens (human)
transforming growth factor beta receptor signaling pathwayFocal adhesion kinase 1Homo sapiens (human)
integrin-mediated signaling pathwayFocal adhesion kinase 1Homo sapiens (human)
axon guidanceFocal adhesion kinase 1Homo sapiens (human)
positive regulation of cell population proliferationFocal adhesion kinase 1Homo sapiens (human)
regulation of cell shapeFocal adhesion kinase 1Homo sapiens (human)
regulation of endothelial cell migrationFocal adhesion kinase 1Homo sapiens (human)
regulation of epithelial cell migrationFocal adhesion kinase 1Homo sapiens (human)
positive regulation of epithelial cell migrationFocal adhesion kinase 1Homo sapiens (human)
positive regulation of epithelial to mesenchymal transitionFocal adhesion kinase 1Homo sapiens (human)
positive regulation of fibroblast migrationFocal adhesion kinase 1Homo sapiens (human)
cell migrationFocal adhesion kinase 1Homo sapiens (human)
peptidyl-tyrosine phosphorylationFocal adhesion kinase 1Homo sapiens (human)
negative regulation of cell-cell adhesionFocal adhesion kinase 1Homo sapiens (human)
establishment of cell polarityFocal adhesion kinase 1Homo sapiens (human)
positive regulation of cell migrationFocal adhesion kinase 1Homo sapiens (human)
regulation of cell adhesion mediated by integrinFocal adhesion kinase 1Homo sapiens (human)
detection of muscle stretchFocal adhesion kinase 1Homo sapiens (human)
netrin-activated signaling pathwayFocal adhesion kinase 1Homo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisFocal adhesion kinase 1Homo sapiens (human)
regulation of cell population proliferationFocal adhesion kinase 1Homo sapiens (human)
negative regulation of apoptotic processFocal adhesion kinase 1Homo sapiens (human)
regulation of GTPase activityFocal adhesion kinase 1Homo sapiens (human)
regulation of osteoblast differentiationFocal adhesion kinase 1Homo sapiens (human)
positive regulation of protein kinase activityFocal adhesion kinase 1Homo sapiens (human)
protein autophosphorylationFocal adhesion kinase 1Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayFocal adhesion kinase 1Homo sapiens (human)
ephrin receptor signaling pathwayFocal adhesion kinase 1Homo sapiens (human)
cell motilityFocal adhesion kinase 1Homo sapiens (human)
regulation of cytoskeleton organizationFocal adhesion kinase 1Homo sapiens (human)
regulation of focal adhesion assemblyFocal adhesion kinase 1Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionFocal adhesion kinase 1Homo sapiens (human)
growth hormone receptor signaling pathwayFocal adhesion kinase 1Homo sapiens (human)
positive regulation of wound healingFocal adhesion kinase 1Homo sapiens (human)
regulation of substrate adhesion-dependent cell spreadingFocal adhesion kinase 1Homo sapiens (human)
positive regulation of ubiquitin-dependent protein catabolic processFocal adhesion kinase 1Homo sapiens (human)
negative regulation of anoikisFocal adhesion kinase 1Homo sapiens (human)
protein phosphorylationFocal adhesion kinase 1Homo sapiens (human)
epidermal growth factor receptor signaling pathwayFocal adhesion kinase 1Homo sapiens (human)
regulation of cell adhesionFocal adhesion kinase 1Homo sapiens (human)
protein phosphorylationProtein kinase C delta typeHomo sapiens (human)
apoptotic processProtein kinase C delta typeHomo sapiens (human)
DNA damage responseProtein kinase C delta typeHomo sapiens (human)
signal transductionProtein kinase C delta typeHomo sapiens (human)
intrinsic apoptotic signaling pathway in response to oxidative stressProtein kinase C delta typeHomo sapiens (human)
regulation of signaling receptor activityProtein kinase C delta typeHomo sapiens (human)
immunoglobulin mediated immune responseProtein kinase C delta typeHomo sapiens (human)
peptidyl-serine phosphorylationProtein kinase C delta typeHomo sapiens (human)
peptidyl-threonine phosphorylationProtein kinase C delta typeHomo sapiens (human)
termination of signal transductionProtein kinase C delta typeHomo sapiens (human)
negative regulation of actin filament polymerizationProtein kinase C delta typeHomo sapiens (human)
positive regulation of endodeoxyribonuclease activityProtein kinase C delta typeHomo sapiens (human)
negative regulation of protein bindingProtein kinase C delta typeHomo sapiens (human)
activation of protein kinase activityProtein kinase C delta typeHomo sapiens (human)
positive regulation of superoxide anion generationProtein kinase C delta typeHomo sapiens (human)
regulation of actin cytoskeleton organizationProtein kinase C delta typeHomo sapiens (human)
negative regulation of glial cell apoptotic processProtein kinase C delta typeHomo sapiens (human)
cellular response to UVProtein kinase C delta typeHomo sapiens (human)
positive regulation of protein dephosphorylationProtein kinase C delta typeHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisProtein kinase C delta typeHomo sapiens (human)
B cell proliferationProtein kinase C delta typeHomo sapiens (human)
neutrophil activationProtein kinase C delta typeHomo sapiens (human)
positive regulation of protein import into nucleusProtein kinase C delta typeHomo sapiens (human)
defense response to bacteriumProtein kinase C delta typeHomo sapiens (human)
negative regulation of MAP kinase activityProtein kinase C delta typeHomo sapiens (human)
regulation of mRNA stabilityProtein kinase C delta typeHomo sapiens (human)
post-translational protein modificationProtein kinase C delta typeHomo sapiens (human)
negative regulation of insulin receptor signaling pathwayProtein kinase C delta typeHomo sapiens (human)
negative regulation of inflammatory responseProtein kinase C delta typeHomo sapiens (human)
negative regulation of peptidyl-tyrosine phosphorylationProtein kinase C delta typeHomo sapiens (human)
protein stabilizationProtein kinase C delta typeHomo sapiens (human)
negative regulation of filopodium assemblyProtein kinase C delta typeHomo sapiens (human)
cell chemotaxisProtein kinase C delta typeHomo sapiens (human)
cellular response to hydrogen peroxideProtein kinase C delta typeHomo sapiens (human)
cellular response to hydroperoxideProtein kinase C delta typeHomo sapiens (human)
negative regulation of platelet aggregationProtein kinase C delta typeHomo sapiens (human)
cellular senescenceProtein kinase C delta typeHomo sapiens (human)
positive regulation of phospholipid scramblase activityProtein kinase C delta typeHomo sapiens (human)
cellular response to angiotensinProtein kinase C delta typeHomo sapiens (human)
regulation of ceramide biosynthetic processProtein kinase C delta typeHomo sapiens (human)
positive regulation of ceramide biosynthetic processProtein kinase C delta typeHomo sapiens (human)
positive regulation of glucosylceramide catabolic processProtein kinase C delta typeHomo sapiens (human)
positive regulation of sphingomyelin catabolic processProtein kinase C delta typeHomo sapiens (human)
positive regulation of apoptotic signaling pathwayProtein kinase C delta typeHomo sapiens (human)
intracellular signal transductionProtein kinase C delta typeHomo sapiens (human)
neutrophil homeostasisTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of type III hypersensitivityTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of type I hypersensitivityTyrosine-protein kinase BTKHomo sapiens (human)
adaptive immune responseTyrosine-protein kinase BTKHomo sapiens (human)
B cell affinity maturationTyrosine-protein kinase BTKHomo sapiens (human)
histamine secretion by mast cellTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of immunoglobulin productionTyrosine-protein kinase BTKHomo sapiens (human)
regulation of B cell cytokine productionTyrosine-protein kinase BTKHomo sapiens (human)
MyD88-dependent toll-like receptor signaling pathwayTyrosine-protein kinase BTKHomo sapiens (human)
regulation of B cell apoptotic processTyrosine-protein kinase BTKHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase BTKHomo sapiens (human)
mesoderm developmentTyrosine-protein kinase BTKHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase BTKHomo sapiens (human)
calcium-mediated signalingTyrosine-protein kinase BTKHomo sapiens (human)
proteoglycan catabolic processTyrosine-protein kinase BTKHomo sapiens (human)
negative regulation of B cell proliferationTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of B cell proliferationTyrosine-protein kinase BTKHomo sapiens (human)
response to lipopolysaccharideTyrosine-protein kinase BTKHomo sapiens (human)
negative regulation of interleukin-10 productionTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of interleukin-6 productionTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of tumor necrosis factor productionTyrosine-protein kinase BTKHomo sapiens (human)
cellular response to reactive oxygen speciesTyrosine-protein kinase BTKHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase BTKHomo sapiens (human)
Fc-epsilon receptor signaling pathwayTyrosine-protein kinase BTKHomo sapiens (human)
B cell activationTyrosine-protein kinase BTKHomo sapiens (human)
innate immune responseTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of B cell differentiationTyrosine-protein kinase BTKHomo sapiens (human)
cell maturationTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of phagocytosisTyrosine-protein kinase BTKHomo sapiens (human)
B cell receptor signaling pathwayTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of NF-kappaB transcription factor activityTyrosine-protein kinase BTKHomo sapiens (human)
monocyte proliferationTyrosine-protein kinase BTKHomo sapiens (human)
cellular response to molecule of fungal originTyrosine-protein kinase BTKHomo sapiens (human)
apoptotic signaling pathwayTyrosine-protein kinase BTKHomo sapiens (human)
cellular response to interleukin-7Tyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of interleukin-17A productionTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of NLRP3 inflammasome complex assemblyTyrosine-protein kinase BTKHomo sapiens (human)
positive regulation of synoviocyte proliferationTyrosine-protein kinase BTKHomo sapiens (human)
eosinophil homeostasisTyrosine-protein kinase BTKHomo sapiens (human)
T cell receptor signaling pathwayTyrosine-protein kinase BTKHomo sapiens (human)
endocytosisActivated CDC42 kinase 1Homo sapiens (human)
cell surface receptor signaling pathwayActivated CDC42 kinase 1Homo sapiens (human)
small GTPase-mediated signal transductionActivated CDC42 kinase 1Homo sapiens (human)
phosphorylationActivated CDC42 kinase 1Homo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationActivated CDC42 kinase 1Homo sapiens (human)
regulation of clathrin-dependent endocytosisActivated CDC42 kinase 1Homo sapiens (human)
protein phosphorylationActivated CDC42 kinase 1Homo sapiens (human)
regulation of cell growthEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
regulation of cell-matrix adhesionEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
cell adhesionEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
embryo implantationEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
lactationEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
cell population proliferationEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
negative regulation of cell population proliferationEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
regulation of extracellular matrix disassemblyEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
smooth muscle cell migrationEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
collagen-activated tyrosine kinase receptor signaling pathwayEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
peptidyl-tyrosine autophosphorylationEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
ear developmentEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
wound healing, spreading of cellsEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
protein autophosphorylationEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
branching involved in mammary gland duct morphogenesisEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
mammary gland alveolus developmentEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
smooth muscle cell-matrix adhesionEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
axon developmentEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
neuron projection extensionEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
multicellular organism developmentEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
positive regulation of kinase activityEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
positive regulation of neuron projection developmentEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
regulation of heart rate by cardiac conductionPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
regulation of heart rate by hormonePotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
regulation of membrane potentialPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
positive regulation of DNA-templated transcriptionPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
potassium ion homeostasisPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
cardiac muscle contractionPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
regulation of membrane repolarizationPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
regulation of ventricular cardiac muscle cell membrane repolarizationPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
cellular response to xenobiotic stimulusPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
potassium ion transmembrane transportPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
ventricular cardiac muscle cell action potentialPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
membrane repolarizationPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
membrane depolarization during action potentialPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
membrane repolarization during action potentialPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
membrane repolarization during cardiac muscle cell action potentialPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
regulation of heart rate by cardiac conductionPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
potassium ion export across plasma membranePotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
membrane repolarization during ventricular cardiac muscle cell action potentialPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
regulation of potassium ion transmembrane transportPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
negative regulation of potassium ion transmembrane transportPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
positive regulation of potassium ion transmembrane transportPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
negative regulation of potassium ion export across plasma membranePotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
potassium ion import across plasma membranePotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
vesicle targetingMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
immune responseMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
positive regulation of JUN kinase activityMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
innate immune responseMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
positive regulation of JNK cascadeMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
cell morphogenesisSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of protein phosphorylationSerine/threonine-protein kinase 4Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of protein bindingSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of peptidyl-serine phosphorylationSerine/threonine-protein kinase 4Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase 4Homo sapiens (human)
protein stabilizationSerine/threonine-protein kinase 4Homo sapiens (human)
branching involved in blood vessel morphogenesisSerine/threonine-protein kinase 4Homo sapiens (human)
neural tube formationSerine/threonine-protein kinase 4Homo sapiens (human)
endocardium developmentSerine/threonine-protein kinase 4Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 4Homo sapiens (human)
protein import into nucleusSerine/threonine-protein kinase 4Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase 4Homo sapiens (human)
signal transductionSerine/threonine-protein kinase 4Homo sapiens (human)
central nervous system developmentSerine/threonine-protein kinase 4Homo sapiens (human)
extrinsic apoptotic signaling pathway via death domain receptorsSerine/threonine-protein kinase 4Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase 4Homo sapiens (human)
keratinocyte differentiationSerine/threonine-protein kinase 4Homo sapiens (human)
organ growthSerine/threonine-protein kinase 4Homo sapiens (human)
hippo signalingSerine/threonine-protein kinase 4Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of apoptotic processSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of fat cell differentiationSerine/threonine-protein kinase 4Homo sapiens (human)
negative regulation of organ growthSerine/threonine-protein kinase 4Homo sapiens (human)
epithelial cell proliferationSerine/threonine-protein kinase 4Homo sapiens (human)
negative regulation of epithelial cell proliferationSerine/threonine-protein kinase 4Homo sapiens (human)
protein tetramerizationSerine/threonine-protein kinase 4Homo sapiens (human)
canonical Wnt signaling pathwaySerine/threonine-protein kinase 4Homo sapiens (human)
primitive hemopoiesisSerine/threonine-protein kinase 4Homo sapiens (human)
cell differentiation involved in embryonic placenta developmentSerine/threonine-protein kinase 4Homo sapiens (human)
regulation of cell differentiation involved in embryonic placenta developmentSerine/threonine-protein kinase 4Homo sapiens (human)
negative regulation of canonical Wnt signaling pathwaySerine/threonine-protein kinase 4Homo sapiens (human)
hepatocyte apoptotic processSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of extrinsic apoptotic signaling pathway via death domain receptorsSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of hepatocyte apoptotic processSerine/threonine-protein kinase 4Homo sapiens (human)
positive regulation of substrate-dependent cell migration, cell attachment to substrateSerine/threonine-protein kinase 4Homo sapiens (human)
regulation of MAPK cascadeSerine/threonine-protein kinase 4Homo sapiens (human)
lipid droplet disassembly5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
response to hypoxia5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
glucose metabolic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
chromatin remodeling5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
protein phosphorylation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
fatty acid biosynthetic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cholesterol biosynthetic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
autophagy5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
signal transduction5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of cell population proliferation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
lipid biosynthetic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
response to UV5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cold acclimation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
response to gamma radiation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of autophagy5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of gene expression5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of gene expression5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
response to activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
bile acid and bile salt transport5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
Wnt signaling pathway5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
fatty acid oxidation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
response to caffeine5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to nutrient levels5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of TOR signaling5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
regulation of peptidyl-serine phosphorylation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to oxidative stress5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
bile acid signaling pathway5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to glucose starvation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
glucose homeostasis5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
regulation of circadian rhythm5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of apoptotic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
response to estrogen5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of cholesterol biosynthetic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of glycolytic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of DNA-templated transcription5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of glucosylceramide biosynthetic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of insulin receptor signaling pathway5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
rhythmic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of skeletal muscle tissue development5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of lipid catabolic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
fatty acid homeostasis5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
regulation of vesicle-mediated transport5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
motor behavior5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
CAMKK-AMPK signaling cascade5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
regulation of stress granule assembly5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
neuron cellular homeostasis5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to hydrogen peroxide5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
regulation of microtubule cytoskeleton organization5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to calcium ion5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to glucose stimulus5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to ethanol5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to prostaglandin E stimulus5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to organonitrogen compound5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to hypoxia5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cellular response to xenobiotic stimulus5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
energy homeostasis5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
regulation of bile acid secretion5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of mitochondrial transcription5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of protein localization5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of hepatocyte apoptotic process5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of protein targeting to mitochondrion5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of adipose tissue development5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of TORC1 signaling5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of tubulin deacetylation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
protein localization to lipid droplet5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
positive regulation of peptidyl-lysine acetylation5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
negative regulation of transcription by RNA polymerase IIDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
heart developmentDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
positive regulation of cell growthDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of NF-kappaB transcription factor activityDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of interleukin-8 productionDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of heterotypic cell-cell adhesionDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of smooth muscle cell apoptotic processDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in apoptotic processDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
positive regulation of MAP kinase activityDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
positive regulation of epithelial cell proliferationDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
positive regulation of protein metabolic processDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of response to cytokine stimulusDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
ERK5 cascadeDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
cellular response to growth factor stimulusDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
cellular response to laminar fluid shear stressDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of cell migration involved in sprouting angiogenesisDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of chemokine (C-X-C motif) ligand 2 productionDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathway in absence of ligandDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase 7Homo sapiens (human)
signal transductionMitogen-activated protein kinase 7Homo sapiens (human)
adenylate cyclase-activating G protein-coupled receptor signaling pathwayMitogen-activated protein kinase 7Homo sapiens (human)
cell differentiationMitogen-activated protein kinase 7Homo sapiens (human)
calcineurin-NFAT signaling cascadeMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of heterotypic cell-cell adhesionMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of smooth muscle cell apoptotic processMitogen-activated protein kinase 7Homo sapiens (human)
regulation of angiogenesisMitogen-activated protein kinase 7Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of inflammatory responseMitogen-activated protein kinase 7Homo sapiens (human)
positive regulation of protein metabolic processMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of response to cytokine stimulusMitogen-activated protein kinase 7Homo sapiens (human)
cellular response to hydrogen peroxideMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of calcineurin-NFAT signaling cascadeMitogen-activated protein kinase 7Homo sapiens (human)
cellular response to growth factor stimulusMitogen-activated protein kinase 7Homo sapiens (human)
cellular response to laminar fluid shear stressMitogen-activated protein kinase 7Homo sapiens (human)
cellular response to transforming growth factor beta stimulusMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathwayMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of endothelial cell apoptotic processMitogen-activated protein kinase 7Homo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathway in absence of ligandMitogen-activated protein kinase 7Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase 7Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase PAK 2Homo sapiens (human)
stimulatory C-type lectin receptor signaling pathwaySerine/threonine-protein kinase PAK 2Homo sapiens (human)
cardiac muscle hypertrophySerine/threonine-protein kinase PAK 2Homo sapiens (human)
negative regulation of protein kinase activitySerine/threonine-protein kinase PAK 2Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase PAK 2Homo sapiens (human)
signal transductionSerine/threonine-protein kinase PAK 2Homo sapiens (human)
phosphorylationSerine/threonine-protein kinase PAK 2Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase PAK 2Homo sapiens (human)
adherens junction assemblySerine/threonine-protein kinase PAK 2Homo sapiens (human)
negative regulation of apoptotic processSerine/threonine-protein kinase PAK 2Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwaySerine/threonine-protein kinase PAK 2Homo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationSerine/threonine-protein kinase PAK 2Homo sapiens (human)
regulation of cytoskeleton organizationSerine/threonine-protein kinase PAK 2Homo sapiens (human)
negative regulation of stress fiber assemblySerine/threonine-protein kinase PAK 2Homo sapiens (human)
dendritic spine developmentSerine/threonine-protein kinase PAK 2Homo sapiens (human)
bicellular tight junction assemblySerine/threonine-protein kinase PAK 2Homo sapiens (human)
cellular response to organic cyclic compoundSerine/threonine-protein kinase PAK 2Homo sapiens (human)
cellular response to transforming growth factor beta stimulusSerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein localization to cell-cell junctionSerine/threonine-protein kinase PAK 2Homo sapiens (human)
positive regulation of extrinsic apoptotic signaling pathwaySerine/threonine-protein kinase PAK 2Homo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosisSerine/threonine-protein kinase PAK 2Homo sapiens (human)
regulation of axonogenesisSerine/threonine-protein kinase PAK 2Homo sapiens (human)
regulation of MAPK cascadeSerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase PAK 2Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase PAK 2Homo sapiens (human)
positive regulation of protein bindingSerine/threonine-protein kinase 3Homo sapiens (human)
protein stabilizationSerine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of DNA-binding transcription factor activitySerine/threonine-protein kinase 3Homo sapiens (human)
neural tube formationSerine/threonine-protein kinase 3Homo sapiens (human)
endocardium developmentSerine/threonine-protein kinase 3Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 3Homo sapiens (human)
protein import into nucleusSerine/threonine-protein kinase 3Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase 3Homo sapiens (human)
JNK cascadeSerine/threonine-protein kinase 3Homo sapiens (human)
central nervous system developmentSerine/threonine-protein kinase 3Homo sapiens (human)
extrinsic apoptotic signaling pathway via death domain receptorsSerine/threonine-protein kinase 3Homo sapiens (human)
organ growthSerine/threonine-protein kinase 3Homo sapiens (human)
hippo signalingSerine/threonine-protein kinase 3Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of apoptotic processSerine/threonine-protein kinase 3Homo sapiens (human)
phosphatidylinositol 3-kinase/protein kinase B signal transductionSerine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of fat cell differentiationSerine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of JNK cascadeSerine/threonine-protein kinase 3Homo sapiens (human)
negative regulation of organ growthSerine/threonine-protein kinase 3Homo sapiens (human)
epithelial cell proliferationSerine/threonine-protein kinase 3Homo sapiens (human)
negative regulation of epithelial cell proliferationSerine/threonine-protein kinase 3Homo sapiens (human)
protein tetramerizationSerine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionSerine/threonine-protein kinase 3Homo sapiens (human)
canonical Wnt signaling pathwaySerine/threonine-protein kinase 3Homo sapiens (human)
primitive hemopoiesisSerine/threonine-protein kinase 3Homo sapiens (human)
cell differentiation involved in embryonic placenta developmentSerine/threonine-protein kinase 3Homo sapiens (human)
regulation of cell differentiation involved in embryonic placenta developmentSerine/threonine-protein kinase 3Homo sapiens (human)
protein localization to centrosomeSerine/threonine-protein kinase 3Homo sapiens (human)
negative regulation of canonical Wnt signaling pathwaySerine/threonine-protein kinase 3Homo sapiens (human)
hepatocyte apoptotic processSerine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of extrinsic apoptotic signaling pathway via death domain receptorsSerine/threonine-protein kinase 3Homo sapiens (human)
regulation of MAPK cascadeSerine/threonine-protein kinase 3Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
Fc-epsilon receptor signaling pathwayMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
cellular response to mechanical stimulusMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
cell morphogenesisIntegrin-linked protein kinaseHomo sapiens (human)
integrin-mediated signaling pathwayIntegrin-linked protein kinaseHomo sapiens (human)
branching involved in ureteric bud morphogenesisIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of protein phosphorylationIntegrin-linked protein kinaseHomo sapiens (human)
outflow tract morphogenesisIntegrin-linked protein kinaseHomo sapiens (human)
protein phosphorylationIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of cell population proliferationIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of signal transductionIntegrin-linked protein kinaseHomo sapiens (human)
fibroblast migrationIntegrin-linked protein kinaseHomo sapiens (human)
nerve developmentIntegrin-linked protein kinaseHomo sapiens (human)
myelination in peripheral nervous systemIntegrin-linked protein kinaseHomo sapiens (human)
cell projection organizationIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of BMP signaling pathwayIntegrin-linked protein kinaseHomo sapiens (human)
tumor necrosis factor-mediated signaling pathwayIntegrin-linked protein kinaseHomo sapiens (human)
substrate adhesion-dependent cell spreadingIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of phosphorylationIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionIntegrin-linked protein kinaseHomo sapiens (human)
phosphatidylinositol 3-kinase/protein kinase B signal transductionIntegrin-linked protein kinaseHomo sapiens (human)
establishment or maintenance of epithelial cell apical/basal polarityIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of osteoblast differentiationIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of DNA-templated transcriptionIntegrin-linked protein kinaseHomo sapiens (human)
neural precursor cell proliferationIntegrin-linked protein kinaseHomo sapiens (human)
platelet aggregationIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of canonical Wnt signaling pathwayIntegrin-linked protein kinaseHomo sapiens (human)
positive regulation of substrate adhesion-dependent cell spreadingIntegrin-linked protein kinaseHomo sapiens (human)
negative regulation of neural precursor cell proliferationIntegrin-linked protein kinaseHomo sapiens (human)
cell-matrix adhesionIntegrin-linked protein kinaseHomo sapiens (human)
integrin-mediated signaling pathwayIntegrin-linked protein kinaseHomo sapiens (human)
epithelial to mesenchymal transitionRho-associated protein kinase 1Homo sapiens (human)
aortic valve morphogenesisRho-associated protein kinase 1Homo sapiens (human)
apical constrictionRho-associated protein kinase 1Homo sapiens (human)
protein phosphorylationRho-associated protein kinase 1Homo sapiens (human)
smooth muscle contractionRho-associated protein kinase 1Homo sapiens (human)
leukocyte cell-cell adhesionRho-associated protein kinase 1Homo sapiens (human)
signal transductionRho-associated protein kinase 1Homo sapiens (human)
canonical NF-kappaB signal transductionRho-associated protein kinase 1Homo sapiens (human)
Rho protein signal transductionRho-associated protein kinase 1Homo sapiens (human)
positive regulation of autophagyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of cardiac muscle hypertrophyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of gene expressionRho-associated protein kinase 1Homo sapiens (human)
positive regulation of phosphatase activityRho-associated protein kinase 1Homo sapiens (human)
negative regulation of angiogenesisRho-associated protein kinase 1Homo sapiens (human)
peptidyl-serine phosphorylationRho-associated protein kinase 1Homo sapiens (human)
membrane to membrane dockingRho-associated protein kinase 1Homo sapiens (human)
actin cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
regulation of cell adhesionRho-associated protein kinase 1Homo sapiens (human)
regulation of cell migrationRho-associated protein kinase 1Homo sapiens (human)
cortical actin cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
neuron projection developmentRho-associated protein kinase 1Homo sapiens (human)
bleb assemblyRho-associated protein kinase 1Homo sapiens (human)
negative regulation of protein bindingRho-associated protein kinase 1Homo sapiens (human)
regulation of actin cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
positive regulation of dephosphorylationRho-associated protein kinase 1Homo sapiens (human)
negative regulation of myosin-light-chain-phosphatase activityRho-associated protein kinase 1Homo sapiens (human)
negative regulation of phosphorylationRho-associated protein kinase 1Homo sapiens (human)
positive regulation of MAPK cascadeRho-associated protein kinase 1Homo sapiens (human)
regulation of keratinocyte differentiationRho-associated protein kinase 1Homo sapiens (human)
regulation of neuron differentiationRho-associated protein kinase 1Homo sapiens (human)
leukocyte migrationRho-associated protein kinase 1Homo sapiens (human)
leukocyte tethering or rollingRho-associated protein kinase 1Homo sapiens (human)
negative regulation of membrane protein ectodomain proteolysisRho-associated protein kinase 1Homo sapiens (human)
myoblast migrationRho-associated protein kinase 1Homo sapiens (human)
regulation of stress fiber assemblyRho-associated protein kinase 1Homo sapiens (human)
regulation of focal adhesion assemblyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of focal adhesion assemblyRho-associated protein kinase 1Homo sapiens (human)
mRNA destabilizationRho-associated protein kinase 1Homo sapiens (human)
negative regulation of biomineral tissue developmentRho-associated protein kinase 1Homo sapiens (human)
regulation of microtubule cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
response to transforming growth factor betaRho-associated protein kinase 1Homo sapiens (human)
protein localization to plasma membraneRho-associated protein kinase 1Homo sapiens (human)
regulation of synapse maturationRho-associated protein kinase 1Homo sapiens (human)
podocyte cell migrationRho-associated protein kinase 1Homo sapiens (human)
motor neuron apoptotic processRho-associated protein kinase 1Homo sapiens (human)
blood vessel diameter maintenanceRho-associated protein kinase 1Homo sapiens (human)
regulation of angiotensin-activated signaling pathwayRho-associated protein kinase 1Homo sapiens (human)
neuron projection arborizationRho-associated protein kinase 1Homo sapiens (human)
positive regulation of amyloid-beta clearanceRho-associated protein kinase 1Homo sapiens (human)
regulation of synaptic vesicle endocytosisRho-associated protein kinase 1Homo sapiens (human)
negative regulation of amyloid-beta formationRho-associated protein kinase 1Homo sapiens (human)
negative regulation of amyloid precursor protein catabolic processRho-associated protein kinase 1Homo sapiens (human)
regulation of establishment of endothelial barrierRho-associated protein kinase 1Homo sapiens (human)
negative regulation of bicellular tight junction assemblyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of connective tissue replacementRho-associated protein kinase 1Homo sapiens (human)
response to angiotensinRho-associated protein kinase 1Homo sapiens (human)
regulation of establishment of cell polarityRho-associated protein kinase 1Homo sapiens (human)
regulation of cell motilityRho-associated protein kinase 1Homo sapiens (human)
negative regulation of motor neuron apoptotic processRho-associated protein kinase 1Homo sapiens (human)
regulation of cell junction assemblyRho-associated protein kinase 1Homo sapiens (human)
mitotic cytokinesisRho-associated protein kinase 1Homo sapiens (human)
embryonic morphogenesisRho-associated protein kinase 1Homo sapiens (human)
peptidyl-threonine phosphorylationRho-associated protein kinase 1Homo sapiens (human)
actomyosin structure organizationRho-associated protein kinase 1Homo sapiens (human)
protein phosphorylationNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
protein autophosphorylationNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
nuclear membrane disassemblySerine/threonine-protein kinase ATRHomo sapiens (human)
DNA damage checkpoint signalingSerine/threonine-protein kinase ATRHomo sapiens (human)
nucleobase-containing compound metabolic processSerine/threonine-protein kinase ATRHomo sapiens (human)
DNA replicationSerine/threonine-protein kinase ATRHomo sapiens (human)
double-strand break repairSerine/threonine-protein kinase ATRHomo sapiens (human)
chromatin remodelingSerine/threonine-protein kinase ATRHomo sapiens (human)
DNA damage responseSerine/threonine-protein kinase ATRHomo sapiens (human)
negative regulation of DNA replicationSerine/threonine-protein kinase ATRHomo sapiens (human)
response to xenobiotic stimulusSerine/threonine-protein kinase ATRHomo sapiens (human)
response to mechanical stimulusSerine/threonine-protein kinase ATRHomo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase ATRHomo sapiens (human)
replication fork processingSerine/threonine-protein kinase ATRHomo sapiens (human)
positive regulation of telomere maintenance via telomeraseSerine/threonine-protein kinase ATRHomo sapiens (human)
cellular response to UVSerine/threonine-protein kinase ATRHomo sapiens (human)
interstrand cross-link repairSerine/threonine-protein kinase ATRHomo sapiens (human)
positive regulation of DNA damage response, signal transduction by p53 class mediatorSerine/threonine-protein kinase ATRHomo sapiens (human)
mitotic G2/M transition checkpointSerine/threonine-protein kinase ATRHomo sapiens (human)
response to arsenic-containing substanceSerine/threonine-protein kinase ATRHomo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase ATRHomo sapiens (human)
protein localization to chromosome, telomeric regionSerine/threonine-protein kinase ATRHomo sapiens (human)
cellular response to gamma radiationSerine/threonine-protein kinase ATRHomo sapiens (human)
replicative senescenceSerine/threonine-protein kinase ATRHomo sapiens (human)
establishment of RNA localization to telomereSerine/threonine-protein kinase ATRHomo sapiens (human)
establishment of protein-containing complex localization to telomereSerine/threonine-protein kinase ATRHomo sapiens (human)
regulation of cellular response to heatSerine/threonine-protein kinase ATRHomo sapiens (human)
positive regulation of telomerase catalytic core complex assemblySerine/threonine-protein kinase ATRHomo sapiens (human)
regulation of double-strand break repairSerine/threonine-protein kinase ATRHomo sapiens (human)
DNA repairSerine/threonine-protein kinase ATRHomo sapiens (human)
telomere maintenanceSerine/threonine-protein kinase ATRHomo sapiens (human)
nervous system developmentCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
regulation of neuron projection developmentCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
regulation of skeletal muscle adaptationCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
insulin secretionCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
cell differentiationCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
regulation of calcium ion transportCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
regulation of cell growthCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of the force of heart contractionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of membrane depolarizationCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of transcription by RNA polymerase IICalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
protein phosphorylationCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of heart contractionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
positive regulation of cardiac muscle hypertrophyCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of cell communication by electrical couplingCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
positive regulation of cardiac muscle cell apoptotic processCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulumCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
peptidyl-serine phosphorylationCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
peptidyl-threonine phosphorylationCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
endoplasmic reticulum calcium ion homeostasisCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
protein autophosphorylationCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
relaxation of cardiac muscleCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of ryanodine-sensitive calcium-release channel activityCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of cellular localizationCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
cellular response to calcium ionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
cardiac muscle cell contractionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of heart rate by cardiac conductionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of cardiac muscle cell action potentialCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of cardiac muscle cell action potential involved in regulation of contractionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of cell communication by electrical coupling involved in cardiac conductionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of relaxation of cardiac muscleCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
negative regulation of sodium ion transmembrane transportCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
regulation of calcium ion transmembrane transport via high voltage-gated calcium channelCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
negative regulation of sodium ion transmembrane transporter activityCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
peptidyl-tyrosine phosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
chromatin remodelingDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
regulation of transcription by RNA polymerase IIDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
protein phosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
nervous system developmentDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
circadian rhythmDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
peptidyl-serine phosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
peptidyl-threonine phosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
peptidyl-tyrosine phosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
negative regulation of microtubule polymerizationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
positive regulation of RNA splicingDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
amyloid-beta formationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
peptidyl-serine autophosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
peptidyl-tyrosine autophosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
negative regulation of DNA damage response, signal transduction by p53 class mediatorDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
protein autophosphorylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
negative regulation of mRNA splicing, via spliceosomeDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
negative regulation of DNA methylation-dependent heterochromatin formationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
positive regulation of protein deacetylationDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
positive regulation of DNA-templated transcriptionDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
negative regulation of transcription by RNA polymerase IIActivin receptor type-2BHomo sapiens (human)
gastrulation with mouth forming secondActivin receptor type-2BHomo sapiens (human)
kidney developmentActivin receptor type-2BHomo sapiens (human)
lymphangiogenesisActivin receptor type-2BHomo sapiens (human)
blood vessel remodelingActivin receptor type-2BHomo sapiens (human)
regulation of DNA-templated transcriptionActivin receptor type-2BHomo sapiens (human)
signal transductionActivin receptor type-2BHomo sapiens (human)
cell surface receptor protein serine/threonine kinase signaling pathwayActivin receptor type-2BHomo sapiens (human)
determination of left/right symmetryActivin receptor type-2BHomo sapiens (human)
mesoderm developmentActivin receptor type-2BHomo sapiens (human)
heart developmentActivin receptor type-2BHomo sapiens (human)
response to glucoseActivin receptor type-2BHomo sapiens (human)
post-embryonic developmentActivin receptor type-2BHomo sapiens (human)
anterior/posterior pattern specificationActivin receptor type-2BHomo sapiens (human)
insulin secretionActivin receptor type-2BHomo sapiens (human)
lung developmentActivin receptor type-2BHomo sapiens (human)
positive regulation of bone mineralizationActivin receptor type-2BHomo sapiens (human)
BMP signaling pathwayActivin receptor type-2BHomo sapiens (human)
pancreas developmentActivin receptor type-2BHomo sapiens (human)
activin receptor signaling pathwayActivin receptor type-2BHomo sapiens (human)
positive regulation of activin receptor signaling pathwayActivin receptor type-2BHomo sapiens (human)
organ growthActivin receptor type-2BHomo sapiens (human)
odontogenesis of dentin-containing toothActivin receptor type-2BHomo sapiens (human)
positive regulation of osteoblast differentiationActivin receptor type-2BHomo sapiens (human)
embryonic foregut morphogenesisActivin receptor type-2BHomo sapiens (human)
skeletal system morphogenesisActivin receptor type-2BHomo sapiens (human)
roof of mouth developmentActivin receptor type-2BHomo sapiens (human)
lymphatic endothelial cell differentiationActivin receptor type-2BHomo sapiens (human)
artery developmentActivin receptor type-2BHomo sapiens (human)
venous blood vessel developmentActivin receptor type-2BHomo sapiens (human)
retina vasculature development in camera-type eyeActivin receptor type-2BHomo sapiens (human)
negative regulation of cold-induced thermogenesisActivin receptor type-2BHomo sapiens (human)
cellular response to growth factor stimulusActivin receptor type-2BHomo sapiens (human)
protein phosphorylationActivin receptor type-2BHomo sapiens (human)
outflow tract septum morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
atrioventricular valve morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
cardiac muscle tissue developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
pharyngeal arch artery morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of gene expressionBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of SMAD protein signal transductionBone morphogenetic protein receptor type-2Homo sapiens (human)
osteoblast differentiationBone morphogenetic protein receptor type-2Homo sapiens (human)
mesoderm formationBone morphogenetic protein receptor type-2Homo sapiens (human)
maternal placenta developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
endothelial cell proliferationBone morphogenetic protein receptor type-2Homo sapiens (human)
lymphangiogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
blood vessel remodelingBone morphogenetic protein receptor type-2Homo sapiens (human)
chondrocyte developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
negative regulation of systemic arterial blood pressureBone morphogenetic protein receptor type-2Homo sapiens (human)
outflow tract morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
aortic valve developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
pulmonary valve developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
mitral valve morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
tricuspid valve morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
endocardial cushion developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
negative regulation of cell proliferation involved in heart valve morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
cell surface receptor protein serine/threonine kinase signaling pathwayBone morphogenetic protein receptor type-2Homo sapiens (human)
cellular response to starvationBone morphogenetic protein receptor type-2Homo sapiens (human)
anterior/posterior pattern specificationBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of epithelial cell migrationBone morphogenetic protein receptor type-2Homo sapiens (human)
regulation of lung blood pressureBone morphogenetic protein receptor type-2Homo sapiens (human)
proteoglycan biosynthetic processBone morphogenetic protein receptor type-2Homo sapiens (human)
negative regulation of cell growthBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of bone mineralizationBone morphogenetic protein receptor type-2Homo sapiens (human)
BMP signaling pathwayBone morphogenetic protein receptor type-2Homo sapiens (human)
activin receptor signaling pathwayBone morphogenetic protein receptor type-2Homo sapiens (human)
regulation of cell population proliferationBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of osteoblast differentiationBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of ossificationBone morphogenetic protein receptor type-2Homo sapiens (human)
negative regulation of vasoconstrictionBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIBone morphogenetic protein receptor type-2Homo sapiens (human)
lung alveolus developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
negative regulation of smooth muscle cell proliferationBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of axon extension involved in axon guidanceBone morphogenetic protein receptor type-2Homo sapiens (human)
negative regulation of muscle cell differentiationBone morphogenetic protein receptor type-2Homo sapiens (human)
limb developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
endochondral bone morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of SMAD protein signal transductionBone morphogenetic protein receptor type-2Homo sapiens (human)
ventricular septum morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
atrial septum morphogenesisBone morphogenetic protein receptor type-2Homo sapiens (human)
lung vasculature developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
lymphatic endothelial cell differentiationBone morphogenetic protein receptor type-2Homo sapiens (human)
artery developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
venous blood vessel developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
positive regulation of cartilage developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
retina vasculature development in camera-type eyeBone morphogenetic protein receptor type-2Homo sapiens (human)
cellular response to BMP stimulusBone morphogenetic protein receptor type-2Homo sapiens (human)
endothelial cell apoptotic processBone morphogenetic protein receptor type-2Homo sapiens (human)
negative regulation of chondrocyte proliferationBone morphogenetic protein receptor type-2Homo sapiens (human)
semi-lunar valve developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
cellular response to growth factor stimulusBone morphogenetic protein receptor type-2Homo sapiens (human)
blood vessel developmentBone morphogenetic protein receptor type-2Homo sapiens (human)
protein phosphorylationBone morphogenetic protein receptor type-2Homo sapiens (human)
protein phosphorylationProtein-tyrosine kinase 6Homo sapiens (human)
tyrosine phosphorylation of STAT proteinProtein-tyrosine kinase 6Homo sapiens (human)
positive regulation of neuron projection developmentProtein-tyrosine kinase 6Homo sapiens (human)
cell migrationProtein-tyrosine kinase 6Homo sapiens (human)
ERBB2 signaling pathwayProtein-tyrosine kinase 6Homo sapiens (human)
positive regulation of tyrosine phosphorylation of STAT proteinProtein-tyrosine kinase 6Homo sapiens (human)
positive regulation of DNA replicationProtein-tyrosine kinase 6Homo sapiens (human)
positive regulation of epidermal growth factor receptor signaling pathwayProtein-tyrosine kinase 6Homo sapiens (human)
positive regulation of cell cycleProtein-tyrosine kinase 6Homo sapiens (human)
negative regulation of growthProtein-tyrosine kinase 6Homo sapiens (human)
protein autophosphorylationProtein-tyrosine kinase 6Homo sapiens (human)
intestinal epithelial cell differentiationProtein-tyrosine kinase 6Homo sapiens (human)
negative regulation of protein tyrosine kinase activityProtein-tyrosine kinase 6Homo sapiens (human)
cellular response to retinoic acidProtein-tyrosine kinase 6Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayProtein-tyrosine kinase 6Homo sapiens (human)
innate immune responseProtein-tyrosine kinase 6Homo sapiens (human)
cell differentiationProtein-tyrosine kinase 6Homo sapiens (human)
positive regulation of receptor signaling pathway via JAK-STATProtein-tyrosine kinase 6Homo sapiens (human)
protein phosphorylationcGMP-dependent protein kinase 1 Homo sapiens (human)
neuron migrationcGMP-dependent protein kinase 1 Homo sapiens (human)
signal transductioncGMP-dependent protein kinase 1 Homo sapiens (human)
positive regulation of cytosolic calcium ion concentrationcGMP-dependent protein kinase 1 Homo sapiens (human)
spermatid developmentcGMP-dependent protein kinase 1 Homo sapiens (human)
negative regulation of inositol phosphate biosynthetic processcGMP-dependent protein kinase 1 Homo sapiens (human)
negative regulation of glutamate secretioncGMP-dependent protein kinase 1 Homo sapiens (human)
dendrite developmentcGMP-dependent protein kinase 1 Homo sapiens (human)
cGMP-mediated signalingcGMP-dependent protein kinase 1 Homo sapiens (human)
cerebellum developmentcGMP-dependent protein kinase 1 Homo sapiens (human)
actin cytoskeleton organizationcGMP-dependent protein kinase 1 Homo sapiens (human)
forebrain developmentcGMP-dependent protein kinase 1 Homo sapiens (human)
positive regulation of circadian rhythmcGMP-dependent protein kinase 1 Homo sapiens (human)
regulation of GTPase activitycGMP-dependent protein kinase 1 Homo sapiens (human)
collateral sproutingcGMP-dependent protein kinase 1 Homo sapiens (human)
relaxation of vascular associated smooth musclecGMP-dependent protein kinase 1 Homo sapiens (human)
cell growth involved in cardiac muscle cell developmentcGMP-dependent protein kinase 1 Homo sapiens (human)
negative regulation of platelet aggregationcGMP-dependent protein kinase 1 Homo sapiens (human)
negative regulation of vascular associated smooth muscle cell proliferationcGMP-dependent protein kinase 1 Homo sapiens (human)
negative regulation of vascular associated smooth muscle cell migrationcGMP-dependent protein kinase 1 Homo sapiens (human)
regulation of testosterone biosynthetic processcGMP-dependent protein kinase 1 Homo sapiens (human)
protein kinase A signalingcGMP-dependent protein kinase 1 Homo sapiens (human)
alternative mRNA splicing, via spliceosomeCyclin-dependent kinase 13Homo sapiens (human)
regulation of signal transductionCyclin-dependent kinase 13Homo sapiens (human)
hemopoiesisCyclin-dependent kinase 13Homo sapiens (human)
positive regulation of transcription elongation by RNA polymerase IICyclin-dependent kinase 13Homo sapiens (human)
positive regulation of transcription by RNA polymerase IICyclin-dependent kinase 13Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 13Homo sapiens (human)
negative regulation of stem cell differentiationCyclin-dependent kinase 13Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 13Homo sapiens (human)
immune responseInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
intrinsic apoptotic signaling pathway in response to DNA damageInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
gene expressionInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
positive regulation of lipid storageInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
positive regulation of type I interferon productionInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
response to interferon-betaInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
regulation of protein-containing complex assemblyInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
mRNA stabilizationInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
positive regulation of DNA-binding transcription factor activityInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
defense response to virusInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
type I interferon-mediated signaling pathwayInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
positive regulation of type I interferon-mediated signaling pathwayInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
interleukin-17-mediated signaling pathwayInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
cellular response to virusInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
peptidyl-serine phosphorylationInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionProtein-tyrosine kinase 2-betaHomo sapiens (human)
MAPK cascadeProtein-tyrosine kinase 2-betaHomo sapiens (human)
oocyte maturationProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to hypoxiaProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of cell-matrix adhesionProtein-tyrosine kinase 2-betaHomo sapiens (human)
sprouting angiogenesisProtein-tyrosine kinase 2-betaHomo sapiens (human)
adaptive immune responseProtein-tyrosine kinase 2-betaHomo sapiens (human)
marginal zone B cell differentiationProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to ischemiaProtein-tyrosine kinase 2-betaHomo sapiens (human)
protein phosphorylationProtein-tyrosine kinase 2-betaHomo sapiens (human)
apoptotic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
cellular defense responseProtein-tyrosine kinase 2-betaHomo sapiens (human)
signal transductionProtein-tyrosine kinase 2-betaHomo sapiens (human)
cell surface receptor signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
signal complex assemblyProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of cytosolic calcium ion concentrationProtein-tyrosine kinase 2-betaHomo sapiens (human)
integrin-mediated signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of cell population proliferationProtein-tyrosine kinase 2-betaHomo sapiens (human)
negative regulation of cell population proliferationProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of cell shapeProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to xenobiotic stimulusProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to mechanical stimulusProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to hormoneProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to glucoseProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of endothelial cell migrationProtein-tyrosine kinase 2-betaHomo sapiens (human)
negative regulation of muscle cell apoptotic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of macrophage chemotaxisProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of neuron projection developmentProtein-tyrosine kinase 2-betaHomo sapiens (human)
glial cell proliferationProtein-tyrosine kinase 2-betaHomo sapiens (human)
peptidyl-tyrosine phosphorylationProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of cell adhesionProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of cell growthProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of cell migrationProtein-tyrosine kinase 2-betaHomo sapiens (human)
negative regulation of bone mineralizationProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of actin filament polymerizationProtein-tyrosine kinase 2-betaHomo sapiens (human)
cortical cytoskeleton organizationProtein-tyrosine kinase 2-betaHomo sapiens (human)
neuron projection developmentProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of actin cytoskeleton organizationProtein-tyrosine kinase 2-betaHomo sapiens (human)
tumor necrosis factor-mediated signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
ionotropic glutamate receptor signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to immobilization stressProtein-tyrosine kinase 2-betaHomo sapiens (human)
peptidyl-tyrosine autophosphorylationProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to cocaineProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to hydrogen peroxideProtein-tyrosine kinase 2-betaHomo sapiens (human)
activation of Janus kinase activityProtein-tyrosine kinase 2-betaHomo sapiens (human)
negative regulation of apoptotic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
stress fiber assemblyProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to cation stressProtein-tyrosine kinase 2-betaHomo sapiens (human)
negative regulation of potassium ion transportProtein-tyrosine kinase 2-betaHomo sapiens (human)
negative regulation of neuron apoptotic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
blood vessel endothelial cell migrationProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of nitric oxide biosynthetic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
bone resorptionProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to ethanolProtein-tyrosine kinase 2-betaHomo sapiens (human)
negative regulation of myeloid cell differentiationProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of translationProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of angiogenesisProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of protein kinase activityProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of JNK cascadeProtein-tyrosine kinase 2-betaHomo sapiens (human)
protein autophosphorylationProtein-tyrosine kinase 2-betaHomo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
focal adhesion assemblyProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of synaptic plasticityProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of release of sequestered calcium ion into cytosolProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to cAMPProtein-tyrosine kinase 2-betaHomo sapiens (human)
response to calcium ionProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of synaptic transmission, glutamatergicProtein-tyrosine kinase 2-betaHomo sapiens (human)
long-term synaptic potentiationProtein-tyrosine kinase 2-betaHomo sapiens (human)
long-term synaptic depressionProtein-tyrosine kinase 2-betaHomo sapiens (human)
protein-containing complex assemblyProtein-tyrosine kinase 2-betaHomo sapiens (human)
chemokine-mediated signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeProtein-tyrosine kinase 2-betaHomo sapiens (human)
cellular response to retinoic acidProtein-tyrosine kinase 2-betaHomo sapiens (human)
cellular response to fluid shear stressProtein-tyrosine kinase 2-betaHomo sapiens (human)
endothelin receptor signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of postsynaptic density assemblyProtein-tyrosine kinase 2-betaHomo sapiens (human)
postsynaptic modulation of chemical synaptic transmissionProtein-tyrosine kinase 2-betaHomo sapiens (human)
regulation of ubiquitin-dependent protein catabolic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of ubiquitin-dependent protein catabolic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of reactive oxygen species metabolic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of excitatory postsynaptic potentialProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of B cell chemotaxisProtein-tyrosine kinase 2-betaHomo sapiens (human)
positive regulation of DNA biosynthetic processProtein-tyrosine kinase 2-betaHomo sapiens (human)
epidermal growth factor receptor signaling pathwayProtein-tyrosine kinase 2-betaHomo sapiens (human)
G2/M transition of mitotic cell cycleMaternal embryonic leucine zipper kinaseHomo sapiens (human)
apoptotic processMaternal embryonic leucine zipper kinaseHomo sapiens (human)
cell population proliferationMaternal embryonic leucine zipper kinaseHomo sapiens (human)
intrinsic apoptotic signaling pathway in response to oxidative stressMaternal embryonic leucine zipper kinaseHomo sapiens (human)
hemopoiesisMaternal embryonic leucine zipper kinaseHomo sapiens (human)
positive regulation of apoptotic processMaternal embryonic leucine zipper kinaseHomo sapiens (human)
protein autophosphorylationMaternal embryonic leucine zipper kinaseHomo sapiens (human)
neural precursor cell proliferationMaternal embryonic leucine zipper kinaseHomo sapiens (human)
protein phosphorylationMaternal embryonic leucine zipper kinaseHomo sapiens (human)
mitotic sister chromatid segregationStructural maintenance of chromosomes protein 1AHomo sapiens (human)
DNA repairStructural maintenance of chromosomes protein 1AHomo sapiens (human)
sister chromatid cohesionStructural maintenance of chromosomes protein 1AHomo sapiens (human)
mitotic sister chromatid cohesionStructural maintenance of chromosomes protein 1AHomo sapiens (human)
response to radiationStructural maintenance of chromosomes protein 1AHomo sapiens (human)
establishment of mitotic sister chromatid cohesionStructural maintenance of chromosomes protein 1AHomo sapiens (human)
establishment of meiotic sister chromatid cohesionStructural maintenance of chromosomes protein 1AHomo sapiens (human)
somatic stem cell population maintenanceStructural maintenance of chromosomes protein 1AHomo sapiens (human)
cell divisionStructural maintenance of chromosomes protein 1AHomo sapiens (human)
meiotic cell cycleStructural maintenance of chromosomes protein 1AHomo sapiens (human)
response to DNA damage checkpoint signalingStructural maintenance of chromosomes protein 1AHomo sapiens (human)
mitotic spindle assemblyStructural maintenance of chromosomes protein 1AHomo sapiens (human)
negative regulation of transcription by RNA polymerase IIChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
double-strand break repair via homologous recombinationChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
chromatin remodelingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
negative regulation of gene expressionChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
regulation of cell fate specificationChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
negative regulation of DNA-templated transcriptionChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
positive regulation of DNA-templated transcriptionChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
regulation of synapse assemblyChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
terminal button organizationChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
regulation of stem cell differentiationChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
very long-chain fatty acid metabolic processPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
generation of precursor metabolites and energyPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
lipid metabolic processPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
prostaglandin metabolic processPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
spermatogenesisPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
fatty acid catabolic processPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
fatty acid oxidationPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
fatty acid beta-oxidation using acyl-CoA oxidasePeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
hydrogen peroxide biosynthetic processPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
very long-chain fatty acid beta-oxidationPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
lipid homeostasisPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
positive regulation of protein phosphorylationEphrin type-A receptor 7Homo sapiens (human)
brain developmentEphrin type-A receptor 7Homo sapiens (human)
phosphorylationEphrin type-A receptor 7Homo sapiens (human)
regulation of cell-cell adhesionEphrin type-A receptor 7Homo sapiens (human)
retinal ganglion cell axon guidanceEphrin type-A receptor 7Homo sapiens (human)
regulation of protein autophosphorylationEphrin type-A receptor 7Homo sapiens (human)
regulation of cysteine-type endopeptidase activity involved in apoptotic processEphrin type-A receptor 7Homo sapiens (human)
positive regulation of neuron apoptotic processEphrin type-A receptor 7Homo sapiens (human)
ephrin receptor signaling pathwayEphrin type-A receptor 7Homo sapiens (human)
negative regulation of collateral sproutingEphrin type-A receptor 7Homo sapiens (human)
branching morphogenesis of a nerveEphrin type-A receptor 7Homo sapiens (human)
regulation of peptidyl-tyrosine phosphorylationEphrin type-A receptor 7Homo sapiens (human)
modulation of chemical synaptic transmissionEphrin type-A receptor 7Homo sapiens (human)
negative chemotaxisEphrin type-A receptor 7Homo sapiens (human)
neuron apoptotic processEphrin type-A receptor 7Homo sapiens (human)
negative regulation of synapse assemblyEphrin type-A receptor 7Homo sapiens (human)
regulation of ERK1 and ERK2 cascadeEphrin type-A receptor 7Homo sapiens (human)
nephric duct morphogenesisEphrin type-A receptor 7Homo sapiens (human)
regulation of postsynapse organizationEphrin type-A receptor 7Homo sapiens (human)
axon guidanceEphrin type-A receptor 7Homo sapiens (human)
protein phosphorylationEphrin type-A receptor 7Homo sapiens (human)
cholesterol biosynthetic processDelta(24)-sterol reductaseHomo sapiens (human)
cholesterol biosynthetic processDelta(24)-sterol reductaseHomo sapiens (human)
Ras protein signal transductionDelta(24)-sterol reductaseHomo sapiens (human)
protein localizationDelta(24)-sterol reductaseHomo sapiens (human)
negative regulation of cell population proliferationDelta(24)-sterol reductaseHomo sapiens (human)
response to hormoneDelta(24)-sterol reductaseHomo sapiens (human)
tissue developmentDelta(24)-sterol reductaseHomo sapiens (human)
male genitalia developmentDelta(24)-sterol reductaseHomo sapiens (human)
plasminogen activationDelta(24)-sterol reductaseHomo sapiens (human)
cholesterol biosynthetic process via desmosterolDelta(24)-sterol reductaseHomo sapiens (human)
cholesterol biosynthetic process via lathosterolDelta(24)-sterol reductaseHomo sapiens (human)
amyloid precursor protein catabolic processDelta(24)-sterol reductaseHomo sapiens (human)
skin developmentDelta(24)-sterol reductaseHomo sapiens (human)
membrane organizationDelta(24)-sterol reductaseHomo sapiens (human)
steroid metabolic processDelta(24)-sterol reductaseHomo sapiens (human)
protein phosphorylationRibosomal protein S6 kinase alpha-1Homo sapiens (human)
signal transductionRibosomal protein S6 kinase alpha-1Homo sapiens (human)
chemical synaptic transmissionRibosomal protein S6 kinase alpha-1Homo sapiens (human)
positive regulation of cell growthRibosomal protein S6 kinase alpha-1Homo sapiens (human)
negative regulation of TOR signalingRibosomal protein S6 kinase alpha-1Homo sapiens (human)
intracellular signal transductionRibosomal protein S6 kinase alpha-1Homo sapiens (human)
negative regulation of apoptotic processRibosomal protein S6 kinase alpha-1Homo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in apoptotic processRibosomal protein S6 kinase alpha-1Homo sapiens (human)
regulation of translation in response to stressRibosomal protein S6 kinase alpha-1Homo sapiens (human)
positive regulation of cell differentiationRibosomal protein S6 kinase alpha-1Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIRibosomal protein S6 kinase alpha-1Homo sapiens (human)
hepatocyte proliferationRibosomal protein S6 kinase alpha-1Homo sapiens (human)
positive regulation of hepatic stellate cell activationRibosomal protein S6 kinase alpha-1Homo sapiens (human)
positive regulation of DNA-templated transcriptionRibosomal protein S6 kinase alpha-1Homo sapiens (human)
peptidyl-serine phosphorylationRibosomal protein S6 kinase alpha-1Homo sapiens (human)
positive regulation of protein phosphorylationDual specificity testis-specific protein kinase 1Homo sapiens (human)
spermatogenesisDual specificity testis-specific protein kinase 1Homo sapiens (human)
negative regulation of protein autophosphorylationDual specificity testis-specific protein kinase 1Homo sapiens (human)
regulation of protein localizationDual specificity testis-specific protein kinase 1Homo sapiens (human)
regulation of actin cytoskeleton organizationDual specificity testis-specific protein kinase 1Homo sapiens (human)
negative regulation of phosphorylationDual specificity testis-specific protein kinase 1Homo sapiens (human)
positive regulation of stress fiber assemblyDual specificity testis-specific protein kinase 1Homo sapiens (human)
establishment of vesicle localizationDual specificity testis-specific protein kinase 1Homo sapiens (human)
negative regulation of protein serine/threonine kinase activityDual specificity testis-specific protein kinase 1Homo sapiens (human)
podocyte cell migrationDual specificity testis-specific protein kinase 1Homo sapiens (human)
positive regulation of substrate adhesion-dependent cell spreadingDual specificity testis-specific protein kinase 1Homo sapiens (human)
positive regulation of protein localization to nucleusDual specificity testis-specific protein kinase 1Homo sapiens (human)
negative regulation of cilium assemblyDual specificity testis-specific protein kinase 1Homo sapiens (human)
actin cytoskeleton organizationDual specificity testis-specific protein kinase 1Homo sapiens (human)
protein phosphorylationMyosin light chain kinase, smooth muscleHomo sapiens (human)
smooth muscle contractionMyosin light chain kinase, smooth muscleHomo sapiens (human)
tonic smooth muscle contractionMyosin light chain kinase, smooth muscleHomo sapiens (human)
positive regulation of cell migrationMyosin light chain kinase, smooth muscleHomo sapiens (human)
bleb assemblyMyosin light chain kinase, smooth muscleHomo sapiens (human)
positive regulation of calcium ion transportMyosin light chain kinase, smooth muscleHomo sapiens (human)
aorta smooth muscle tissue morphogenesisMyosin light chain kinase, smooth muscleHomo sapiens (human)
cellular hypotonic responseMyosin light chain kinase, smooth muscleHomo sapiens (human)
positive regulation of wound healingMyosin light chain kinase, smooth muscleHomo sapiens (human)
positive regulation of erythrocyte differentiationMitogen-activated protein kinase 11Homo sapiens (human)
osteoblast differentiationMitogen-activated protein kinase 11Homo sapiens (human)
positive regulation of gene expressionMitogen-activated protein kinase 11Homo sapiens (human)
stress-activated protein kinase signaling cascadeMitogen-activated protein kinase 11Homo sapiens (human)
positive regulation of interleukin-12 productionMitogen-activated protein kinase 11Homo sapiens (human)
p38MAPK cascadeMitogen-activated protein kinase 11Homo sapiens (human)
positive regulation of muscle cell differentiationMitogen-activated protein kinase 11Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase 11Homo sapiens (human)
cardiac muscle cell proliferationMitogen-activated protein kinase 11Homo sapiens (human)
negative regulation of cardiac muscle cell proliferationMitogen-activated protein kinase 11Homo sapiens (human)
bone developmentMitogen-activated protein kinase 11Homo sapiens (human)
cellular response to interleukin-1Mitogen-activated protein kinase 11Homo sapiens (human)
cellular response to UV-BMitogen-activated protein kinase 11Homo sapiens (human)
cellular senescenceMitogen-activated protein kinase 11Homo sapiens (human)
cellular response to virusMitogen-activated protein kinase 11Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase 11Homo sapiens (human)
G1 to G0 transitionSerine/threonine-protein kinase STK11Homo sapiens (human)
regulation of cell growthSerine/threonine-protein kinase STK11Homo sapiens (human)
tissue homeostasisSerine/threonine-protein kinase STK11Homo sapiens (human)
vasculature developmentSerine/threonine-protein kinase STK11Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase STK11Homo sapiens (human)
protein dephosphorylationSerine/threonine-protein kinase STK11Homo sapiens (human)
autophagySerine/threonine-protein kinase STK11Homo sapiens (human)
DNA damage responseSerine/threonine-protein kinase STK11Homo sapiens (human)
spermatogenesisSerine/threonine-protein kinase STK11Homo sapiens (human)
axonogenesisSerine/threonine-protein kinase STK11Homo sapiens (human)
negative regulation of cell population proliferationSerine/threonine-protein kinase STK11Homo sapiens (human)
response to ionizing radiationSerine/threonine-protein kinase STK11Homo sapiens (human)
positive regulation of autophagySerine/threonine-protein kinase STK11Homo sapiens (human)
response to activitySerine/threonine-protein kinase STK11Homo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase STK11Homo sapiens (human)
establishment of cell polaritySerine/threonine-protein kinase STK11Homo sapiens (human)
negative regulation of cell growthSerine/threonine-protein kinase STK11Homo sapiens (human)
positive regulation of transforming growth factor beta receptor signaling pathwaySerine/threonine-protein kinase STK11Homo sapiens (human)
activation of protein kinase activitySerine/threonine-protein kinase STK11Homo sapiens (human)
response to glucagonSerine/threonine-protein kinase STK11Homo sapiens (human)
response to lipidSerine/threonine-protein kinase STK11Homo sapiens (human)
protein localization to nucleusSerine/threonine-protein kinase STK11Homo sapiens (human)
glucose homeostasisSerine/threonine-protein kinase STK11Homo sapiens (human)
anoikisSerine/threonine-protein kinase STK11Homo sapiens (human)
positive thymic T cell selectionSerine/threonine-protein kinase STK11Homo sapiens (human)
positive regulation of gluconeogenesisSerine/threonine-protein kinase STK11Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase STK11Homo sapiens (human)
regulation of dendrite morphogenesisSerine/threonine-protein kinase STK11Homo sapiens (human)
positive regulation of axonogenesisSerine/threonine-protein kinase STK11Homo sapiens (human)
T cell receptor signaling pathwaySerine/threonine-protein kinase STK11Homo sapiens (human)
Golgi localizationSerine/threonine-protein kinase STK11Homo sapiens (human)
regulation of cell cycleSerine/threonine-protein kinase STK11Homo sapiens (human)
regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionSerine/threonine-protein kinase STK11Homo sapiens (human)
epithelial cell proliferation involved in prostate gland developmentSerine/threonine-protein kinase STK11Homo sapiens (human)
negative regulation of epithelial cell proliferation involved in prostate gland developmentSerine/threonine-protein kinase STK11Homo sapiens (human)
cellular response to UV-BSerine/threonine-protein kinase STK11Homo sapiens (human)
intrinsic apoptotic signaling pathway by p53 class mediatorSerine/threonine-protein kinase STK11Homo sapiens (human)
negative regulation of canonical Wnt signaling pathwaySerine/threonine-protein kinase STK11Homo sapiens (human)
response to thyroid hormoneSerine/threonine-protein kinase STK11Homo sapiens (human)
dendrite extensionSerine/threonine-protein kinase STK11Homo sapiens (human)
negative regulation of cold-induced thermogenesisSerine/threonine-protein kinase STK11Homo sapiens (human)
positive regulation of protein localization to nucleusSerine/threonine-protein kinase STK11Homo sapiens (human)
positive regulation of vesicle transport along microtubuleSerine/threonine-protein kinase STK11Homo sapiens (human)
regulation of signal transduction by p53 class mediatorSerine/threonine-protein kinase STK11Homo sapiens (human)
negative regulation of TORC1 signalingSerine/threonine-protein kinase STK11Homo sapiens (human)
signal transductionSerine/threonine-protein kinase STK11Homo sapiens (human)
regulation of Wnt signaling pathwaySerine/threonine-protein kinase STK11Homo sapiens (human)
B cell homeostasisSerine/threonine-protein kinase N1Homo sapiens (human)
B cell apoptotic processSerine/threonine-protein kinase N1Homo sapiens (human)
negative regulation of protein phosphorylationSerine/threonine-protein kinase N1Homo sapiens (human)
regulation of germinal center formationSerine/threonine-protein kinase N1Homo sapiens (human)
regulation of immunoglobulin productionSerine/threonine-protein kinase N1Homo sapiens (human)
renal system processSerine/threonine-protein kinase N1Homo sapiens (human)
chromatin remodelingSerine/threonine-protein kinase N1Homo sapiens (human)
regulation of transcription by RNA polymerase IISerine/threonine-protein kinase N1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase N1Homo sapiens (human)
hyperosmotic responseSerine/threonine-protein kinase N1Homo sapiens (human)
signal transductionSerine/threonine-protein kinase N1Homo sapiens (human)
epithelial cell migrationSerine/threonine-protein kinase N1Homo sapiens (human)
negative regulation of B cell proliferationSerine/threonine-protein kinase N1Homo sapiens (human)
post-translational protein modificationSerine/threonine-protein kinase N1Homo sapiens (human)
positive regulation of DNA-templated transcriptionSerine/threonine-protein kinase N1Homo sapiens (human)
spleen developmentSerine/threonine-protein kinase N1Homo sapiens (human)
regulation of androgen receptor signaling pathwaySerine/threonine-protein kinase N1Homo sapiens (human)
regulation of cell motilitySerine/threonine-protein kinase N1Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase N1Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase N1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase N2Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase N2Homo sapiens (human)
cell adhesionSerine/threonine-protein kinase N2Homo sapiens (human)
signal transductionSerine/threonine-protein kinase N2Homo sapiens (human)
epithelial cell migrationSerine/threonine-protein kinase N2Homo sapiens (human)
cell projection organizationSerine/threonine-protein kinase N2Homo sapiens (human)
positive regulation of cytokinesisSerine/threonine-protein kinase N2Homo sapiens (human)
apical junction assemblySerine/threonine-protein kinase N2Homo sapiens (human)
positive regulation of viral genome replicationSerine/threonine-protein kinase N2Homo sapiens (human)
positive regulation of mitotic cell cycleSerine/threonine-protein kinase N2Homo sapiens (human)
cell divisionSerine/threonine-protein kinase N2Homo sapiens (human)
regulation of cell motilitySerine/threonine-protein kinase N2Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase N2Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase N2Homo sapiens (human)
positive regulation of blood vessel endothelial cell migrationMitogen-activated protein kinase 14Homo sapiens (human)
cellular response to lipopolysaccharideMitogen-activated protein kinase 14Homo sapiens (human)
DNA damage checkpoint signalingMitogen-activated protein kinase 14Homo sapiens (human)
cell morphogenesisMitogen-activated protein kinase 14Homo sapiens (human)
cartilage condensationMitogen-activated protein kinase 14Homo sapiens (human)
angiogenesisMitogen-activated protein kinase 14Homo sapiens (human)
osteoblast differentiationMitogen-activated protein kinase 14Homo sapiens (human)
placenta developmentMitogen-activated protein kinase 14Homo sapiens (human)
response to dietary excessMitogen-activated protein kinase 14Homo sapiens (human)
chondrocyte differentiationMitogen-activated protein kinase 14Homo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusMitogen-activated protein kinase 14Homo sapiens (human)
glucose metabolic processMitogen-activated protein kinase 14Homo sapiens (human)
regulation of transcription by RNA polymerase IIMitogen-activated protein kinase 14Homo sapiens (human)
transcription by RNA polymerase IIMitogen-activated protein kinase 14Homo sapiens (human)
apoptotic processMitogen-activated protein kinase 14Homo sapiens (human)
chemotaxisMitogen-activated protein kinase 14Homo sapiens (human)
signal transductionMitogen-activated protein kinase 14Homo sapiens (human)
cell surface receptor signaling pathwayMitogen-activated protein kinase 14Homo sapiens (human)
cell surface receptor protein serine/threonine kinase signaling pathwayMitogen-activated protein kinase 14Homo sapiens (human)
skeletal muscle tissue developmentMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of gene expressionMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of myotube differentiationMitogen-activated protein kinase 14Homo sapiens (human)
peptidyl-serine phosphorylationMitogen-activated protein kinase 14Homo sapiens (human)
fatty acid oxidationMitogen-activated protein kinase 14Homo sapiens (human)
platelet activationMitogen-activated protein kinase 14Homo sapiens (human)
regulation of ossificationMitogen-activated protein kinase 14Homo sapiens (human)
osteoclast differentiationMitogen-activated protein kinase 14Homo sapiens (human)
stress-activated protein kinase signaling cascadeMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of cyclase activityMitogen-activated protein kinase 14Homo sapiens (human)
lipopolysaccharide-mediated signaling pathwayMitogen-activated protein kinase 14Homo sapiens (human)
response to muramyl dipeptideMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of interleukin-12 productionMitogen-activated protein kinase 14Homo sapiens (human)
response to insulinMitogen-activated protein kinase 14Homo sapiens (human)
negative regulation of hippo signalingMitogen-activated protein kinase 14Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase 14Homo sapiens (human)
cellular response to vascular endothelial growth factor stimulusMitogen-activated protein kinase 14Homo sapiens (human)
response to muscle stretchMitogen-activated protein kinase 14Homo sapiens (human)
p38MAPK cascadeMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of protein import into nucleusMitogen-activated protein kinase 14Homo sapiens (human)
signal transduction in response to DNA damageMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of erythrocyte differentiationMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of myoblast differentiationMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of transcription by RNA polymerase IIMitogen-activated protein kinase 14Homo sapiens (human)
glucose importMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of glucose importMitogen-activated protein kinase 14Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayMitogen-activated protein kinase 14Homo sapiens (human)
stem cell differentiationMitogen-activated protein kinase 14Homo sapiens (human)
striated muscle cell differentiationMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of muscle cell differentiationMitogen-activated protein kinase 14Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of cardiac muscle cell proliferationMitogen-activated protein kinase 14Homo sapiens (human)
bone developmentMitogen-activated protein kinase 14Homo sapiens (human)
3'-UTR-mediated mRNA stabilizationMitogen-activated protein kinase 14Homo sapiens (human)
cellular response to lipoteichoic acidMitogen-activated protein kinase 14Homo sapiens (human)
cellular response to tumor necrosis factorMitogen-activated protein kinase 14Homo sapiens (human)
cellular response to ionizing radiationMitogen-activated protein kinase 14Homo sapiens (human)
cellular response to UV-BMitogen-activated protein kinase 14Homo sapiens (human)
negative regulation of canonical Wnt signaling pathwayMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of brown fat cell differentiationMitogen-activated protein kinase 14Homo sapiens (human)
cellular senescenceMitogen-activated protein kinase 14Homo sapiens (human)
stress-induced premature senescenceMitogen-activated protein kinase 14Homo sapiens (human)
cellular response to virusMitogen-activated protein kinase 14Homo sapiens (human)
regulation of synaptic membrane adhesionMitogen-activated protein kinase 14Homo sapiens (human)
regulation of cytokine production involved in inflammatory responseMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of myoblast fusionMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of reactive oxygen species metabolic processMitogen-activated protein kinase 14Homo sapiens (human)
positive regulation of myeloid dendritic cell cytokine productionCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
adaptive immune responseCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
protein phosphorylationCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
inflammatory responseCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
signal transductionCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
long-term memoryCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
regulation of T cell differentiation in thymusCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
myeloid dendritic cell differentiationCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
regulation of osteoclast differentiationCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
positive regulation of DNA-templated transcriptionCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
protein autophosphorylationCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
peptidyl-serine phosphorylationCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
intracellular signal transductionCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
microtubule-based processMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
positive regulation of JUN kinase activityMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
positive regulation of neuron apoptotic processMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
cell cycle G1/S phase transitionMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
positive regulation of JNK cascadeMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
protein autophosphorylationMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
positive regulation of apoptotic processMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
ossificationDiscoidin domain-containing receptor 2Homo sapiens (human)
endochondral bone growthDiscoidin domain-containing receptor 2Homo sapiens (human)
cell adhesionDiscoidin domain-containing receptor 2Homo sapiens (human)
signal transductionDiscoidin domain-containing receptor 2Homo sapiens (human)
regulation of extracellular matrix disassemblyDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of fibroblast migrationDiscoidin domain-containing receptor 2Homo sapiens (human)
peptidyl-tyrosine phosphorylationDiscoidin domain-containing receptor 2Homo sapiens (human)
collagen fibril organizationDiscoidin domain-containing receptor 2Homo sapiens (human)
regulation of bone mineralizationDiscoidin domain-containing receptor 2Homo sapiens (human)
biomineral tissue developmentDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of collagen biosynthetic processDiscoidin domain-containing receptor 2Homo sapiens (human)
regulation of tissue remodelingDiscoidin domain-containing receptor 2Homo sapiens (human)
chondrocyte proliferationDiscoidin domain-containing receptor 2Homo sapiens (human)
response to muscle stretchDiscoidin domain-containing receptor 2Homo sapiens (human)
collagen-activated tyrosine kinase receptor signaling pathwayDiscoidin domain-containing receptor 2Homo sapiens (human)
negative regulation of apoptotic processDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of osteoblast differentiationDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of protein kinase activityDiscoidin domain-containing receptor 2Homo sapiens (human)
protein autophosphorylationDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of fibroblast proliferationDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of DNA-binding transcription factor activityDiscoidin domain-containing receptor 2Homo sapiens (human)
cellular response to hypoxiaDiscoidin domain-containing receptor 2Homo sapiens (human)
cellular response to transforming growth factor beta stimulusDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of extracellular matrix disassemblyDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of wound healingDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of G1/S transition of mitotic cell cycleDiscoidin domain-containing receptor 2Homo sapiens (human)
negative regulation of hydrogen peroxide-mediated programmed cell deathDiscoidin domain-containing receptor 2Homo sapiens (human)
cellular response to angiotensinDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell migrationDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of hepatic stellate cell proliferationDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of hepatic stellate cell activationDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of neuron projection developmentDiscoidin domain-containing receptor 2Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionDiscoidin domain-containing receptor 2Homo sapiens (human)
multicellular organism developmentDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of kinase activityDiscoidin domain-containing receptor 2Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeDiscoidin domain-containing receptor 2Homo sapiens (human)
protein phosphorylationAP2-associated protein kinase 1Homo sapiens (human)
regulation of protein localizationAP2-associated protein kinase 1Homo sapiens (human)
positive regulation of Notch signaling pathwayAP2-associated protein kinase 1Homo sapiens (human)
protein stabilizationAP2-associated protein kinase 1Homo sapiens (human)
membrane organizationAP2-associated protein kinase 1Homo sapiens (human)
presynaptic endocytosisAP2-associated protein kinase 1Homo sapiens (human)
regulation of clathrin-dependent endocytosisAP2-associated protein kinase 1Homo sapiens (human)
regulation of vascular permeability involved in acute inflammatory responseMyosin light chain kinase 3Homo sapiens (human)
protein phosphorylationMyosin light chain kinase 3Homo sapiens (human)
sarcomere organizationMyosin light chain kinase 3Homo sapiens (human)
sarcomerogenesisMyosin light chain kinase 3Homo sapiens (human)
cardiac myofibril assemblyMyosin light chain kinase 3Homo sapiens (human)
positive regulation of sarcomere organizationMyosin light chain kinase 3Homo sapiens (human)
cellular response to interleukin-1Myosin light chain kinase 3Homo sapiens (human)
biological_processPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
cellular response to heatPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
protein stabilizationPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
protein foldingPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
natural killer cell differentiationRab-like protein 3Homo sapiens (human)
B cell differentiationRab-like protein 3Homo sapiens (human)
T cell differentiation in thymusRab-like protein 3Homo sapiens (human)
regulation of Ras protein signal transductionRab-like protein 3Homo sapiens (human)
protein stabilizationRab-like protein 3Homo sapiens (human)
regulation of protein lipidationRab-like protein 3Homo sapiens (human)
intracellular protein transportRab-like protein 3Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
cell migrationSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
actin cytoskeleton organizationSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
actomyosin structure organizationSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
actin cytoskeleton organizationSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
actomyosin structure organizationSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
fatty acid beta-oxidationAcyl-CoA dehydrogenase family member 10Homo sapiens (human)
fatty acid beta-oxidation using acyl-CoA dehydrogenaseAcyl-CoA dehydrogenase family member 10Homo sapiens (human)
autophagySerine/threonine-protein kinase ULK3Homo sapiens (human)
smoothened signaling pathwaySerine/threonine-protein kinase ULK3Homo sapiens (human)
negative regulation of smoothened signaling pathwaySerine/threonine-protein kinase ULK3Homo sapiens (human)
positive regulation of smoothened signaling pathwaySerine/threonine-protein kinase ULK3Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase ULK3Homo sapiens (human)
fibroblast activationSerine/threonine-protein kinase ULK3Homo sapiens (human)
cellular senescenceSerine/threonine-protein kinase ULK3Homo sapiens (human)
reticulophagySerine/threonine-protein kinase ULK3Homo sapiens (human)
piecemeal microautophagy of the nucleusSerine/threonine-protein kinase ULK3Homo sapiens (human)
response to starvationSerine/threonine-protein kinase ULK3Homo sapiens (human)
autophagosome assemblySerine/threonine-protein kinase ULK3Homo sapiens (human)
autophagy of mitochondrionSerine/threonine-protein kinase ULK3Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase ULK3Homo sapiens (human)
regulation of autophagySerine/threonine-protein kinase ULK3Homo sapiens (human)
fatty acid beta-oxidationAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
fatty acid beta-oxidation using acyl-CoA dehydrogenaseAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
mRNA processingSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
rRNA catabolic processSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
apoptotic chromosome condensationSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
response to endoplasmic reticulum stressSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
negative regulation of DNA-templated transcriptionSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
IRE1-mediated unfolded protein responseSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stressSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
autophagy of mitochondrionSerine/threonine-protein kinase MARK2Homo sapiens (human)
neuron migrationSerine/threonine-protein kinase MARK2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase MARK2Homo sapiens (human)
positive regulation of neuron projection developmentSerine/threonine-protein kinase MARK2Homo sapiens (human)
Wnt signaling pathwaySerine/threonine-protein kinase MARK2Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase MARK2Homo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase MARK2Homo sapiens (human)
establishment of cell polaritySerine/threonine-protein kinase MARK2Homo sapiens (human)
activation of protein kinase activitySerine/threonine-protein kinase MARK2Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase MARK2Homo sapiens (human)
establishment or maintenance of epithelial cell apical/basal polaritySerine/threonine-protein kinase MARK2Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase MARK2Homo sapiens (human)
regulation of axonogenesisSerine/threonine-protein kinase MARK2Homo sapiens (human)
regulation of cytoskeleton organizationSerine/threonine-protein kinase MARK2Homo sapiens (human)
mitochondrion localizationSerine/threonine-protein kinase MARK2Homo sapiens (human)
axon developmentSerine/threonine-protein kinase MARK2Homo sapiens (human)
regulation of microtubule cytoskeleton organizationSerine/threonine-protein kinase MARK2Homo sapiens (human)
establishment or maintenance of cell polarity regulating cell shapeSerine/threonine-protein kinase MARK2Homo sapiens (human)
regulation of microtubule bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
microtubule cytoskeleton organizationSerine/threonine-protein kinase MARK2Homo sapiens (human)
central nervous system developmentATP-dependent RNA helicase DHX30Homo sapiens (human)
DNA duplex unwindingATP-dependent RNA helicase DHX30Homo sapiens (human)
mitochondrial large ribosomal subunit assemblyATP-dependent RNA helicase DHX30Homo sapiens (human)
microtubule cytoskeleton organizationSerine/threonine-protein kinase TAO1Homo sapiens (human)
DNA repairSerine/threonine-protein kinase TAO1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase TAO1Homo sapiens (human)
DNA damage responseSerine/threonine-protein kinase TAO1Homo sapiens (human)
negative regulation of microtubule depolymerizationSerine/threonine-protein kinase TAO1Homo sapiens (human)
mitotic G2 DNA damage checkpoint signalingSerine/threonine-protein kinase TAO1Homo sapiens (human)
phosphorylationSerine/threonine-protein kinase TAO1Homo sapiens (human)
central nervous system neuron developmentSerine/threonine-protein kinase TAO1Homo sapiens (human)
positive regulation of stress-activated MAPK cascadeSerine/threonine-protein kinase TAO1Homo sapiens (human)
regulation of actin cytoskeleton organizationSerine/threonine-protein kinase TAO1Homo sapiens (human)
positive regulation of JNK cascadeSerine/threonine-protein kinase TAO1Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase TAO1Homo sapiens (human)
regulation of cytoskeleton organizationSerine/threonine-protein kinase TAO1Homo sapiens (human)
neuron cellular homeostasisSerine/threonine-protein kinase TAO1Homo sapiens (human)
regulation of microtubule cytoskeleton organizationSerine/threonine-protein kinase TAO1Homo sapiens (human)
execution phase of apoptosisSerine/threonine-protein kinase TAO1Homo sapiens (human)
positive regulation of protein acetylationSerine/threonine-protein kinase TAO1Homo sapiens (human)
protein phosphorylationSTE20-related kinase adapter protein alphaHomo sapiens (human)
G1 to G0 transitionSTE20-related kinase adapter protein alphaHomo sapiens (human)
protein export from nucleusSTE20-related kinase adapter protein alphaHomo sapiens (human)
activation of protein kinase activitySTE20-related kinase adapter protein alphaHomo sapiens (human)
skeletal muscle contractionMyosin-14Homo sapiens (human)
mitochondrion organizationMyosin-14Homo sapiens (human)
skeletal muscle tissue developmentMyosin-14Homo sapiens (human)
sensory perception of soundMyosin-14Homo sapiens (human)
regulation of cell shapeMyosin-14Homo sapiens (human)
neuronal action potentialMyosin-14Homo sapiens (human)
actin filament-based movementMyosin-14Homo sapiens (human)
actomyosin structure organizationMyosin-14Homo sapiens (human)
vocalization behaviorMyosin-14Homo sapiens (human)
negative regulation of mitochondrial fusionAarF domain-containing protein kinase 1Homo sapiens (human)
positive regulation of cristae formationAarF domain-containing protein kinase 1Homo sapiens (human)
mitochondrion organizationAarF domain-containing protein kinase 1Homo sapiens (human)
lipid homeostasisAarF domain-containing protein kinase 1Homo sapiens (human)
protein localizationATP-dependent RNA helicase DDX42Homo sapiens (human)
regulation of apoptotic processATP-dependent RNA helicase DDX42Homo sapiens (human)
U2-type prespliceosome assemblyATP-dependent RNA helicase DDX42Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
response to UVMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
response to tumor necrosis factorMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
MAPK cascadeMAP kinase-activated protein kinase 5Homo sapiens (human)
regulation of translationMAP kinase-activated protein kinase 5Homo sapiens (human)
signal transductionMAP kinase-activated protein kinase 5Homo sapiens (human)
Ras protein signal transductionMAP kinase-activated protein kinase 5Homo sapiens (human)
negative regulation of TOR signalingMAP kinase-activated protein kinase 5Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseMAP kinase-activated protein kinase 5Homo sapiens (human)
protein autophosphorylationMAP kinase-activated protein kinase 5Homo sapiens (human)
positive regulation of telomerase activityMAP kinase-activated protein kinase 5Homo sapiens (human)
positive regulation of dendritic spine developmentMAP kinase-activated protein kinase 5Homo sapiens (human)
cellular senescenceMAP kinase-activated protein kinase 5Homo sapiens (human)
stress-induced premature senescenceMAP kinase-activated protein kinase 5Homo sapiens (human)
regulation of signal transduction by p53 class mediatorMAP kinase-activated protein kinase 5Homo sapiens (human)
positive regulation of telomere cappingMAP kinase-activated protein kinase 5Homo sapiens (human)
peptidyl-serine phosphorylationMAP kinase-activated protein kinase 5Homo sapiens (human)
microvillus assemblyMisshapen-like kinase 1Homo sapiens (human)
regulation of cell-matrix adhesionMisshapen-like kinase 1Homo sapiens (human)
protein phosphorylationMisshapen-like kinase 1Homo sapiens (human)
JNK cascadeMisshapen-like kinase 1Homo sapiens (human)
chemical synaptic transmissionMisshapen-like kinase 1Homo sapiens (human)
brain developmentMisshapen-like kinase 1Homo sapiens (human)
regulation of cell-cell adhesionMisshapen-like kinase 1Homo sapiens (human)
actin cytoskeleton organizationMisshapen-like kinase 1Homo sapiens (human)
regulation of cell migrationMisshapen-like kinase 1Homo sapiens (human)
positive regulation of JNK cascadeMisshapen-like kinase 1Homo sapiens (human)
protein autophosphorylationMisshapen-like kinase 1Homo sapiens (human)
dendrite morphogenesisMisshapen-like kinase 1Homo sapiens (human)
positive regulation of p38MAPK cascadeMisshapen-like kinase 1Homo sapiens (human)
regulation of AMPA receptor activityMisshapen-like kinase 1Homo sapiens (human)
MAPK cascadeMisshapen-like kinase 1Homo sapiens (human)
neuron projection morphogenesisMisshapen-like kinase 1Homo sapiens (human)
regulation of MAPK cascadeMisshapen-like kinase 1Homo sapiens (human)
protein phosphorylationAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
ubiquinone biosynthetic processAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
phosphorylationAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
regulation of autophagyPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
negative regulation of insulin receptor signaling pathwayPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic processPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
positive regulation of autophagosome assemblyPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
phosphatidylinositol phosphate biosynthetic processPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
MAPK cascadeMitogen-activated protein kinase 15Homo sapiens (human)
regulation of COPII vesicle coatingMitogen-activated protein kinase 15Homo sapiens (human)
DNA damage responseMitogen-activated protein kinase 15Homo sapiens (human)
endoplasmic reticulum organizationMitogen-activated protein kinase 15Homo sapiens (human)
positive regulation of cell population proliferationMitogen-activated protein kinase 15Homo sapiens (human)
regulation of autophagyMitogen-activated protein kinase 15Homo sapiens (human)
negative regulation of cell migrationMitogen-activated protein kinase 15Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseMitogen-activated protein kinase 15Homo sapiens (human)
protein autophosphorylationMitogen-activated protein kinase 15Homo sapiens (human)
positive regulation of telomerase activityMitogen-activated protein kinase 15Homo sapiens (human)
dopamine uptakeMitogen-activated protein kinase 15Homo sapiens (human)
regulation of cilium assemblyMitogen-activated protein kinase 15Homo sapiens (human)
positive regulation of telomere cappingMitogen-activated protein kinase 15Homo sapiens (human)
protein localization to ciliary transition zoneMitogen-activated protein kinase 15Homo sapiens (human)
positive regulation of metaphase/anaphase transition of meiosis IMitogen-activated protein kinase 15Homo sapiens (human)
positive regulation of spindle assemblyMitogen-activated protein kinase 15Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase 15Homo sapiens (human)
mitotic cell cycleSerine/threonine-protein kinase Nek9Homo sapiens (human)
regulation of mitotic cell cycleSerine/threonine-protein kinase Nek9Homo sapiens (human)
cell divisionSerine/threonine-protein kinase Nek9Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase Nek7Homo sapiens (human)
regulation of mitotic cell cycleSerine/threonine-protein kinase Nek7Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseSerine/threonine-protein kinase Nek7Homo sapiens (human)
cellular response to potassium ionSerine/threonine-protein kinase Nek7Homo sapiens (human)
spindle assemblySerine/threonine-protein kinase Nek7Homo sapiens (human)
positive regulation of telomerase activitySerine/threonine-protein kinase Nek7Homo sapiens (human)
positive regulation of NLRP3 inflammasome complex assemblySerine/threonine-protein kinase Nek7Homo sapiens (human)
positive regulation of telomere cappingSerine/threonine-protein kinase Nek7Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase Nek7Homo sapiens (human)
spliceosomal complex assemblyATP-dependent RNA helicase DDX1Homo sapiens (human)
positive regulation of myeloid dendritic cell cytokine productionATP-dependent RNA helicase DDX1Homo sapiens (human)
double-strand break repairATP-dependent RNA helicase DDX1Homo sapiens (human)
tRNA splicing, via endonucleolytic cleavage and ligationATP-dependent RNA helicase DDX1Homo sapiens (human)
regulation of translational initiationATP-dependent RNA helicase DDX1Homo sapiens (human)
DNA duplex unwindingATP-dependent RNA helicase DDX1Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionATP-dependent RNA helicase DDX1Homo sapiens (human)
response to exogenous dsRNAATP-dependent RNA helicase DDX1Homo sapiens (human)
innate immune responseATP-dependent RNA helicase DDX1Homo sapiens (human)
defense response to virusATP-dependent RNA helicase DDX1Homo sapiens (human)
nucleic acid metabolic processATP-dependent RNA helicase DDX1Homo sapiens (human)
protein localization to cytoplasmic stress granuleATP-dependent RNA helicase DDX1Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
cell population proliferationMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
peptidyl-serine phosphorylationMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
positive regulation of MAPK cascadeMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
protein autophosphorylationMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
cellular response to phorbol 13-acetate 12-myristateMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
negative regulation of transcription by RNA polymerase IIAurora kinase BHomo sapiens (human)
mitotic cell cycleAurora kinase BHomo sapiens (human)
mitotic cytokinesisAurora kinase BHomo sapiens (human)
negative regulation of B cell apoptotic processAurora kinase BHomo sapiens (human)
protein phosphorylationAurora kinase BHomo sapiens (human)
spindle organizationAurora kinase BHomo sapiens (human)
attachment of spindle microtubules to kinetochoreAurora kinase BHomo sapiens (human)
abscissionAurora kinase BHomo sapiens (human)
negative regulation of protein bindingAurora kinase BHomo sapiens (human)
positive regulation of telomere maintenance via telomeraseAurora kinase BHomo sapiens (human)
negative regulation of cytokinesisAurora kinase BHomo sapiens (human)
positive regulation of cytokinesisAurora kinase BHomo sapiens (human)
protein localization to kinetochoreAurora kinase BHomo sapiens (human)
cellular response to UVAurora kinase BHomo sapiens (human)
cleavage furrow formationAurora kinase BHomo sapiens (human)
post-translational protein modificationAurora kinase BHomo sapiens (human)
cell cycle G2/M phase transitionAurora kinase BHomo sapiens (human)
mitotic cytokinesis checkpoint signalingAurora kinase BHomo sapiens (human)
negative regulation of innate immune responseAurora kinase BHomo sapiens (human)
protein autophosphorylationAurora kinase BHomo sapiens (human)
mitotic spindle midzone assemblyAurora kinase BHomo sapiens (human)
positive regulation of telomerase activityAurora kinase BHomo sapiens (human)
regulation of chromosome segregationAurora kinase BHomo sapiens (human)
positive regulation of mitotic sister chromatid segregationAurora kinase BHomo sapiens (human)
positive regulation of mitotic cell cycle spindle assembly checkpointAurora kinase BHomo sapiens (human)
mitotic spindle assemblyAurora kinase BHomo sapiens (human)
negative regulation of cGAS/STING signaling pathwayAurora kinase BHomo sapiens (human)
regulation of signal transduction by p53 class mediatorAurora kinase BHomo sapiens (human)
positive regulation of mitotic sister chromatid separationAurora kinase BHomo sapiens (human)
positive regulation of attachment of mitotic spindle microtubules to kinetochoreAurora kinase BHomo sapiens (human)
positive regulation of mitotic cytokinesisAurora kinase BHomo sapiens (human)
positive regulation of telomere cappingAurora kinase BHomo sapiens (human)
positive regulation of lateral attachment of mitotic spindle microtubules to kinetochoreAurora kinase BHomo sapiens (human)
mitotic spindle organizationAurora kinase BHomo sapiens (human)
regulation of cytokinesisAurora kinase BHomo sapiens (human)
microtubule cytoskeleton organizationMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
positive regulation of cell cycleMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
microtubule cytoskeleton organizationMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
microtubule bundle formationMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
protein phosphorylationMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
nervous system developmentMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
positive regulation of programmed cell deathMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
cilium organizationMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
positive regulation of cilium assemblyMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
regulation of centrosome cycleMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
cell divisionMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
positive regulation of NLRP3 inflammasome complex assemblyMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
positive regulation of protein localization to centrosomeMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
intracellular signal transductionMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase Nek1Homo sapiens (human)
cell divisionSerine/threonine-protein kinase Nek1Homo sapiens (human)
cilium assemblySerine/threonine-protein kinase Nek1Homo sapiens (human)
MAPK cascadeCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
positive regulation of protein phosphorylationCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
protein phosphorylationCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
calcium-mediated signalingCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
cellular response to reactive oxygen speciesCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
regulation of protein kinase activityCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
positive regulation of DNA-templated transcriptionCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
protein autophosphorylationCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
CAMKK-AMPK signaling cascadeCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
positive regulation of autophagy of mitochondrionCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
protein phosphorylationEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
tRNA processingEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
regulation of signal transduction by p53 class mediatorEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
tRNA threonylcarbamoyladenosine metabolic processEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
regulation of cyclin-dependent protein serine/threonine kinase activityMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
G2/M transition of mitotic cell cycleMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
mitotic cell cycleMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
regulation of mitotic nuclear divisionMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
negative regulation of G2/M transition of mitotic cell cycleMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
protein phosphorylationMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
negative regulation of G2/MI transition of meiotic cell cycleMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
meiotic cell cycleMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
response to ischemiaMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to oxidative stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of cardiac muscle cell apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to amino acid starvationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
response to endoplasmic reticulum stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
neuron intrinsic apoptotic signaling pathway in response to oxidative stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
p38MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of cysteine-type endopeptidase activity involved in apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of JUN kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
innate immune responseMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of myoblast differentiationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of protein kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of DNA-templated transcriptionMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of JNK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
neuron apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to hydrogen peroxideMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to tumor necrosis factorMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
endothelial cell apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular senescenceMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
apoptotic signaling pathwayMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
programmed necrotic cell deathMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of p38MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to reactive nitrogen speciesMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
protein autophosphorylationMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
blood vessel developmentMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
positive regulation of cell proliferation in bone marrowMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
positive regulation of cell migration involved in sprouting angiogenesisMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
positive regulation of p38MAPK cascadeMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
negative regulation of cellular senescenceMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
acute inflammatory responseEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
phagocytosisEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
negative regulation of cell population proliferationEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
regulation of eIF2 alpha phosphorylation by hemeEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
macrophage differentiationEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
negative regulation of translational initiation by ironEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
protoporphyrinogen IX metabolic processEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
protein autophosphorylationEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
negative regulation of hemoglobin biosynthetic processEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
establishment of localization in cellEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
multicellular organismal-level iron ion homeostasisEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
integrated stress response signalingEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
HRI-mediated signalingEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
positive regulation of mitophagyEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
response to iron ion starvationEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
regulation of translational initiation by eIF2 alpha phosphorylationEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
regulation of cyclin-dependent protein serine/threonine kinase activityNucleolar GTP-binding protein 1Homo sapiens (human)
maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)Nucleolar GTP-binding protein 1Homo sapiens (human)
osteoblast differentiationNucleolar GTP-binding protein 1Homo sapiens (human)
negative regulation of DNA replicationNucleolar GTP-binding protein 1Homo sapiens (human)
negative regulation of cell population proliferationNucleolar GTP-binding protein 1Homo sapiens (human)
negative regulation of cell-cell adhesionNucleolar GTP-binding protein 1Homo sapiens (human)
negative regulation of cell migrationNucleolar GTP-binding protein 1Homo sapiens (human)
negative regulation of protein ubiquitinationNucleolar GTP-binding protein 1Homo sapiens (human)
negative regulation of collagen bindingNucleolar GTP-binding protein 1Homo sapiens (human)
ribosomal large subunit biogenesisNucleolar GTP-binding protein 1Homo sapiens (human)
protein stabilizationNucleolar GTP-binding protein 1Homo sapiens (human)
angiogenesisSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of endothelial cell proliferationSerine/threonine-protein kinase D2Homo sapiens (human)
adaptive immune responseSerine/threonine-protein kinase D2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase D2Homo sapiens (human)
cell adhesionSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of endothelial cell migrationSerine/threonine-protein kinase D2Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase D2Homo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase D2Homo sapiens (human)
sphingolipid biosynthetic processSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of vascular endothelial growth factor receptor signaling pathwaySerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of interleukin-2 productionSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of interleukin-8 productionSerine/threonine-protein kinase D2Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase D2Homo sapiens (human)
cellular response to vascular endothelial growth factor stimulusSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of blood vessel endothelial cell migrationSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of fibroblast growth factor receptor signaling pathwaySerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of angiogenesisSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of cell adhesionSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of transcription by RNA polymerase IISerine/threonine-protein kinase D2Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase D2Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwaySerine/threonine-protein kinase D2Homo sapiens (human)
T cell receptor signaling pathwaySerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of T cell receptor signaling pathwaySerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of DNA-binding transcription factor activitySerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activitySerine/threonine-protein kinase D2Homo sapiens (human)
endothelial tube morphogenesisSerine/threonine-protein kinase D2Homo sapiens (human)
regulation of T cell apoptotic processSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of DNA biosynthetic processSerine/threonine-protein kinase D2Homo sapiens (human)
positive regulation of endothelial cell chemotaxisSerine/threonine-protein kinase D2Homo sapiens (human)
phospholipase C-activating G protein-coupled receptor signaling pathwaySerine/threonine-protein kinase D2Homo sapiens (human)
protein phosphorylationNUAK family SNF1-like kinase 2Homo sapiens (human)
apoptotic processNUAK family SNF1-like kinase 2Homo sapiens (human)
actin cytoskeleton organizationNUAK family SNF1-like kinase 2Homo sapiens (human)
protein localization to nucleusNUAK family SNF1-like kinase 2Homo sapiens (human)
regulation of hippo signalingNUAK family SNF1-like kinase 2Homo sapiens (human)
cellular response to glucose starvationNUAK family SNF1-like kinase 2Homo sapiens (human)
negative regulation of apoptotic processNUAK family SNF1-like kinase 2Homo sapiens (human)
rRNA modificationRNA cytidine acetyltransferaseHomo sapiens (human)
regulation of translationRNA cytidine acetyltransferaseHomo sapiens (human)
protein acetylationRNA cytidine acetyltransferaseHomo sapiens (human)
regulation of centrosome duplicationRNA cytidine acetyltransferaseHomo sapiens (human)
negative regulation of telomere maintenance via telomeraseRNA cytidine acetyltransferaseHomo sapiens (human)
ribosomal small subunit biogenesisRNA cytidine acetyltransferaseHomo sapiens (human)
positive regulation of translationRNA cytidine acetyltransferaseHomo sapiens (human)
tRNA acetylationRNA cytidine acetyltransferaseHomo sapiens (human)
rRNA acetylation involved in maturation of SSU-rRNARNA cytidine acetyltransferaseHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase SIK2Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase SIK2Homo sapiens (human)
regulation of insulin receptor signaling pathwaySerine/threonine-protein kinase SIK2Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase SIK2Homo sapiens (human)
apoptotic processSTE20-like serine/threonine-protein kinase Homo sapiens (human)
regulation of cell migrationSTE20-like serine/threonine-protein kinase Homo sapiens (human)
cytoplasmic microtubule organizationSTE20-like serine/threonine-protein kinase Homo sapiens (human)
regulation of apoptotic processSTE20-like serine/threonine-protein kinase Homo sapiens (human)
protein autophosphorylationSTE20-like serine/threonine-protein kinase Homo sapiens (human)
regulation of focal adhesion assemblySTE20-like serine/threonine-protein kinase Homo sapiens (human)
protein phosphorylationSTE20-like serine/threonine-protein kinase Homo sapiens (human)
MAPK cascadeSerine/threonine-protein kinase TAO3Homo sapiens (human)
DNA repairSerine/threonine-protein kinase TAO3Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase TAO3Homo sapiens (human)
DNA damage responseSerine/threonine-protein kinase TAO3Homo sapiens (human)
mitotic G2 DNA damage checkpoint signalingSerine/threonine-protein kinase TAO3Homo sapiens (human)
positive regulation of stress-activated MAPK cascadeSerine/threonine-protein kinase TAO3Homo sapiens (human)
positive regulation of JUN kinase activitySerine/threonine-protein kinase TAO3Homo sapiens (human)
negative regulation of JNK cascadeSerine/threonine-protein kinase TAO3Homo sapiens (human)
positive regulation of JNK cascadeSerine/threonine-protein kinase TAO3Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase TAO3Homo sapiens (human)
regulation of MAPK cascadeSerine/threonine-protein kinase TAO3Homo sapiens (human)
neuron projection morphogenesisSerine/threonine-protein kinase TAO3Homo sapiens (human)
dTTP catabolic processdCTP pyrophosphatase 1Homo sapiens (human)
dCTP catabolic processdCTP pyrophosphatase 1Homo sapiens (human)
nucleoside triphosphate catabolic processdCTP pyrophosphatase 1Homo sapiens (human)
DNA protectiondCTP pyrophosphatase 1Homo sapiens (human)
regulation of RNA splicingDual specificity protein kinase CLK4Homo sapiens (human)
peptidyl-tyrosine phosphorylationDual specificity protein kinase CLK4Homo sapiens (human)
Wnt signaling pathwayCasein kinase I isoform gamma-1Homo sapiens (human)
positive regulation of canonical Wnt signaling pathwayCasein kinase I isoform gamma-1Homo sapiens (human)
signal transductionCasein kinase I isoform gamma-1Homo sapiens (human)
endocytosisCasein kinase I isoform gamma-1Homo sapiens (human)
peptidyl-serine phosphorylationCasein kinase I isoform gamma-1Homo sapiens (human)
regulation of DNA-templated transcriptionSerine/threonine-protein kinase PAK 6Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase PAK 6Homo sapiens (human)
cytoskeleton organizationSerine/threonine-protein kinase PAK 6Homo sapiens (human)
learningSerine/threonine-protein kinase PAK 6Homo sapiens (human)
memorySerine/threonine-protein kinase PAK 6Homo sapiens (human)
locomotory behaviorSerine/threonine-protein kinase PAK 6Homo sapiens (human)
neuron projection arborizationSerine/threonine-protein kinase PAK 6Homo sapiens (human)
neuron projection extensionSerine/threonine-protein kinase PAK 6Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase PAK 6Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase PAK 6Homo sapiens (human)
regulation of MAPK cascadeSerine/threonine-protein kinase PAK 6Homo sapiens (human)
translationPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
phenylalanyl-tRNA aminoacylationPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
protein heterotetramerizationPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
tRNA aminoacylation for protein translationIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
aminoacyl-tRNA metabolism involved in translational fidelityIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
isoleucyl-tRNA aminoacylationIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
mitochondrial translationIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
positive regulation of Notch signaling pathwayBMP-2-inducible protein kinaseHomo sapiens (human)
regulation of clathrin-dependent endocytosisBMP-2-inducible protein kinaseHomo sapiens (human)
regulation of bone mineralizationBMP-2-inducible protein kinaseHomo sapiens (human)
ATP metabolic processObg-like ATPase 1Homo sapiens (human)
ribosomal large subunit assemblyMidasinHomo sapiens (human)
ribosomal large subunit export from nucleusMidasinHomo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
toll-like receptor signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
neutrophil mediated immunityInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
MyD88-dependent toll-like receptor signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
JNK cascadeInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
toll-like receptor 4 signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
toll-like receptor 9 signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
interleukin-33-mediated signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
innate immune responseInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
positive regulation of smooth muscle cell proliferationInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
interleukin-1-mediated signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
neutrophil migrationInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
cytokine-mediated signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
Toll signaling pathwayInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
cellular response to lipopolysaccharideInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
intracellular signal transductionInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
positive regulation of programmed cell deathMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
GCN2-mediated signalingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
pyroptosisMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
DNA damage checkpoint signalingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
inflammatory responseMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cytoskeleton organizationMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cell deathMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cell differentiationMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
stress-activated protein kinase signaling cascadeMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
p38MAPK cascadeMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
embryonic digit morphogenesisMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
positive regulation of apoptotic processMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
protein autophosphorylationMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
limb developmentMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cellular response to gamma radiationMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cellular response to UV-BMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
positive regulation of mitotic DNA damage checkpointMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
peptidyl-serine phosphorylationMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
regulation of mitotic metaphase/anaphase transitionMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
chromosome segregationMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
transcription by RNA polymerase IICyclin-dependent kinase 12Homo sapiens (human)
mRNA processingCyclin-dependent kinase 12Homo sapiens (human)
RNA splicingCyclin-dependent kinase 12Homo sapiens (human)
positive regulation of transcription elongation by RNA polymerase IICyclin-dependent kinase 12Homo sapiens (human)
regulation of MAP kinase activityCyclin-dependent kinase 12Homo sapiens (human)
positive regulation of transcription by RNA polymerase IICyclin-dependent kinase 12Homo sapiens (human)
protein autophosphorylationCyclin-dependent kinase 12Homo sapiens (human)
regulation of cell cycleCyclin-dependent kinase 12Homo sapiens (human)
negative regulation of stem cell differentiationCyclin-dependent kinase 12Homo sapiens (human)
protein phosphorylationCyclin-dependent kinase 12Homo sapiens (human)
aerobic respirationNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
negative regulation of cell growthNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
mitochondrial respiratory chain complex I assemblyNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
cellular response to interferon-betaNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
proton motive force-driven mitochondrial ATP synthesisNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
protein insertion into mitochondrial inner membraneNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
positive regulation of protein catabolic processNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
negative regulation of DNA-templated transcriptionNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
cellular response to retinoic acidNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
reactive oxygen species metabolic processNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
apoptotic signaling pathwayNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
extrinsic apoptotic signaling pathwayNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
positive regulation of execution phase of apoptosisNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
negative regulation of intrinsic apoptotic signaling pathwayNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
G1/S transition of mitotic cell cycleSerine/threonine-protein kinase pim-2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase pim-2Homo sapiens (human)
negative regulation of cell population proliferationSerine/threonine-protein kinase pim-2Homo sapiens (human)
apoptotic mitochondrial changesSerine/threonine-protein kinase pim-2Homo sapiens (human)
response to virusSerine/threonine-protein kinase pim-2Homo sapiens (human)
positive regulation of autophagySerine/threonine-protein kinase pim-2Homo sapiens (human)
macroautophagySerine/threonine-protein kinase pim-2Homo sapiens (human)
positive regulation of macroautophagySerine/threonine-protein kinase pim-2Homo sapiens (human)
negative regulation of apoptotic processSerine/threonine-protein kinase pim-2Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionSerine/threonine-protein kinase pim-2Homo sapiens (human)
positive regulation of DNA-templated transcriptionSerine/threonine-protein kinase pim-2Homo sapiens (human)
protein stabilizationSerine/threonine-protein kinase pim-2Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase pim-2Homo sapiens (human)
regulation of mitotic cell cycleSerine/threonine-protein kinase pim-2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 26Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase 26Homo sapiens (human)
cellular response to starvationSerine/threonine-protein kinase 26Homo sapiens (human)
microvillus assemblySerine/threonine-protein kinase 26Homo sapiens (human)
negative regulation of cell migrationSerine/threonine-protein kinase 26Homo sapiens (human)
cellular response to oxidative stressSerine/threonine-protein kinase 26Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase 26Homo sapiens (human)
regulation of apoptotic processSerine/threonine-protein kinase 26Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase 26Homo sapiens (human)
tricarboxylic acid cycleSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
succinate metabolic processSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
succinyl-CoA pathwaySuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
succinyl-CoA catabolic processSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
succinyl-CoA metabolic processSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
MAPK cascadeSerine/threonine-protein kinase NLKHomo sapiens (human)
regulation of DNA-templated transcriptionSerine/threonine-protein kinase NLKHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase NLKHomo sapiens (human)
transforming growth factor beta receptor signaling pathwaySerine/threonine-protein kinase NLKHomo sapiens (human)
Wnt signaling pathway, calcium modulating pathwaySerine/threonine-protein kinase NLKHomo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase NLKHomo sapiens (human)
negative regulation of Wnt signaling pathwaySerine/threonine-protein kinase NLKHomo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase NLKHomo sapiens (human)
protein stabilizationSerine/threonine-protein kinase NLKHomo sapiens (human)
cellular response to osmotic stressSerine/threonine-protein kinase NLKHomo sapiens (human)
negative regulation of TORC1 signalingSerine/threonine-protein kinase NLKHomo sapiens (human)
positive regulation of receptor signaling pathway via STATSerine/threonine-protein kinase NLKHomo sapiens (human)
glycogen metabolic process5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
regulation of glycolytic process5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
negative regulation of protein kinase activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
fatty acid biosynthetic process5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
ATP biosynthetic process5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
positive regulation of peptidyl-threonine phosphorylation5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
sterol biosynthetic process5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
regulation of fatty acid metabolic process5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
cellular response to nutrient levels5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
intracellular signal transduction5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
positive regulation of protein kinase activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
regulation of fatty acid oxidation5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
regulation of glucose import5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
regulation of catalytic activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
protein phosphorylation5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
activation of innate immune responseSerine/threonine-protein kinase TBK1Homo sapiens (human)
cytoplasmic pattern recognition receptor signaling pathwaySerine/threonine-protein kinase TBK1Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase TBK1Homo sapiens (human)
inflammatory responseSerine/threonine-protein kinase TBK1Homo sapiens (human)
canonical NF-kappaB signal transductionSerine/threonine-protein kinase TBK1Homo sapiens (human)
response to virusSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of autophagySerine/threonine-protein kinase TBK1Homo sapiens (human)
negative regulation of gene expressionSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of macroautophagySerine/threonine-protein kinase TBK1Homo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase TBK1Homo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase TBK1Homo sapiens (human)
regulation of type I interferon productionSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of type I interferon productionSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of interferon-alpha productionSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of interferon-beta productionSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of peptidyl-serine phosphorylationSerine/threonine-protein kinase TBK1Homo sapiens (human)
toll-like receptor 4 signaling pathwaySerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionSerine/threonine-protein kinase TBK1Homo sapiens (human)
dendritic cell proliferationSerine/threonine-protein kinase TBK1Homo sapiens (human)
innate immune responseSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of transcription by RNA polymerase IISerine/threonine-protein kinase TBK1Homo sapiens (human)
defense response to Gram-positive bacteriumSerine/threonine-protein kinase TBK1Homo sapiens (human)
defense response to virusSerine/threonine-protein kinase TBK1Homo sapiens (human)
type I interferon-mediated signaling pathwaySerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of type I interferon-mediated signaling pathwaySerine/threonine-protein kinase TBK1Homo sapiens (human)
antiviral innate immune responseSerine/threonine-protein kinase TBK1Homo sapiens (human)
cGAS/STING signaling pathwaySerine/threonine-protein kinase TBK1Homo sapiens (human)
negative regulation of TORC1 signalingSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of TORC1 signalingSerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of xenophagySerine/threonine-protein kinase TBK1Homo sapiens (human)
macroautophagySerine/threonine-protein kinase TBK1Homo sapiens (human)
positive regulation of non-motile cilium assemblySeptin-9Homo sapiens (human)
protein localizationSeptin-9Homo sapiens (human)
cytoskeleton-dependent cytokinesisSeptin-9Homo sapiens (human)
DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediatorRibosomal protein S6 kinase alpha-6Homo sapiens (human)
signal transductionRibosomal protein S6 kinase alpha-6Homo sapiens (human)
central nervous system developmentRibosomal protein S6 kinase alpha-6Homo sapiens (human)
negative regulation of embryonic developmentRibosomal protein S6 kinase alpha-6Homo sapiens (human)
negative regulation of ERK1 and ERK2 cascadeRibosomal protein S6 kinase alpha-6Homo sapiens (human)
negative regulation of mesoderm developmentRibosomal protein S6 kinase alpha-6Homo sapiens (human)
peptidyl-serine phosphorylationRibosomal protein S6 kinase alpha-6Homo sapiens (human)
positive regulation of protein phosphorylationTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
protein phosphorylationTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
cytoskeleton organizationTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
response to organonitrogen compoundTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
Wnt signaling pathwayTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
microvillus assemblyTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
actin cytoskeleton organizationTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
intracellular signal transductionTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
positive regulation of JNK cascadeTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
protein autophosphorylationTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
regulation of dendrite morphogenesisTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
protein localization to plasma membraneTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
neuron projection morphogenesisTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
regulation of MAPK cascadeTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
MAPK cascadeTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
regulation of cell growthSerine/threonine-protein kinase TAO2Homo sapiens (human)
protein targeting to membraneSerine/threonine-protein kinase TAO2Homo sapiens (human)
apoptotic processSerine/threonine-protein kinase TAO2Homo sapiens (human)
DNA damage responseSerine/threonine-protein kinase TAO2Homo sapiens (human)
mitotic G2 DNA damage checkpoint signalingSerine/threonine-protein kinase TAO2Homo sapiens (human)
axonogenesisSerine/threonine-protein kinase TAO2Homo sapiens (human)
regulation of cell shapeSerine/threonine-protein kinase TAO2Homo sapiens (human)
cell migrationSerine/threonine-protein kinase TAO2Homo sapiens (human)
actin cytoskeleton organizationSerine/threonine-protein kinase TAO2Homo sapiens (human)
positive regulation of protein autophosphorylationSerine/threonine-protein kinase TAO2Homo sapiens (human)
activation of protein kinase activitySerine/threonine-protein kinase TAO2Homo sapiens (human)
positive regulation of stress-activated MAPK cascadeSerine/threonine-protein kinase TAO2Homo sapiens (human)
regulation of actin cytoskeleton organizationSerine/threonine-protein kinase TAO2Homo sapiens (human)
positive regulation of MAPK cascadeSerine/threonine-protein kinase TAO2Homo sapiens (human)
positive regulation of JNK cascadeSerine/threonine-protein kinase TAO2Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase TAO2Homo sapiens (human)
focal adhesion assemblySerine/threonine-protein kinase TAO2Homo sapiens (human)
stress-activated MAPK cascadeSerine/threonine-protein kinase TAO2Homo sapiens (human)
basal dendrite morphogenesisSerine/threonine-protein kinase TAO2Homo sapiens (human)
basal dendrite arborizationSerine/threonine-protein kinase TAO2Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase TAO2Homo sapiens (human)
protein autophosphorylationALK tyrosine kinase receptorHomo sapiens (human)
signal transductionALK tyrosine kinase receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayALK tyrosine kinase receptorHomo sapiens (human)
phosphorylationALK tyrosine kinase receptorHomo sapiens (human)
hippocampus developmentALK tyrosine kinase receptorHomo sapiens (human)
adult behaviorALK tyrosine kinase receptorHomo sapiens (human)
swimming behaviorALK tyrosine kinase receptorHomo sapiens (human)
peptidyl-tyrosine autophosphorylationALK tyrosine kinase receptorHomo sapiens (human)
regulation of apoptotic processALK tyrosine kinase receptorHomo sapiens (human)
protein autophosphorylationALK tyrosine kinase receptorHomo sapiens (human)
neuron developmentALK tyrosine kinase receptorHomo sapiens (human)
negative regulation of lipid catabolic processALK tyrosine kinase receptorHomo sapiens (human)
positive regulation of NF-kappaB transcription factor activityALK tyrosine kinase receptorHomo sapiens (human)
regulation of dopamine receptor signaling pathwayALK tyrosine kinase receptorHomo sapiens (human)
response to environmental enrichmentALK tyrosine kinase receptorHomo sapiens (human)
energy homeostasisALK tyrosine kinase receptorHomo sapiens (human)
positive regulation of dendrite developmentALK tyrosine kinase receptorHomo sapiens (human)
regulation of neuron differentiationALK tyrosine kinase receptorHomo sapiens (human)
regulation of cell population proliferationALK tyrosine kinase receptorHomo sapiens (human)
multicellular organism developmentALK tyrosine kinase receptorHomo sapiens (human)
positive regulation of kinase activityALK tyrosine kinase receptorHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase ICKHomo sapiens (human)
signal transductionSerine/threonine-protein kinase ICKHomo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase ICKHomo sapiens (human)
intraciliary anterograde transportSerine/threonine-protein kinase ICKHomo sapiens (human)
intraciliary retrograde transportSerine/threonine-protein kinase ICKHomo sapiens (human)
intraciliary transportSerine/threonine-protein kinase ICKHomo sapiens (human)
cilium assemblySerine/threonine-protein kinase ICKHomo sapiens (human)
mitochondrial genome maintenanceRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of endothelial cell proliferationRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
protein phosphorylationRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
signal transductionRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of TOR signalingRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of blood vessel endothelial cell migrationRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of angiogenesisRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell sizeRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
brain morphogenesisRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
homeostasis of number of cells within a tissueRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell migration involved in sprouting angiogenesisRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of vascular endothelial cell proliferationRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of artery morphogenesisRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of cellular senescenceRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
intracellular signal transductionRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
peptidyl-serine phosphorylationRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 38-likeHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 38-likeHomo sapiens (human)
negative regulation of autophagySerine/threonine-protein kinase 38-likeHomo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase 38-likeHomo sapiens (human)
regulation of cellular component organizationSerine/threonine-protein kinase 38-likeHomo sapiens (human)
postsynapse organizationSerine/threonine-protein kinase 38-likeHomo sapiens (human)
peptidyl-serine phosphorylationSerine/threonine-protein kinase 38-likeHomo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase SIK3Homo sapiens (human)
positive regulation of TORC1 signalingSerine/threonine-protein kinase SIK3Homo sapiens (human)
positive regulation of TORC2 signalingSerine/threonine-protein kinase SIK3Homo sapiens (human)
microtubule cytoskeleton organizationSerine/threonine-protein kinase SIK3Homo sapiens (human)
intracellular signal transductionSerine/threonine-protein kinase SIK3Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
cellular response to mechanical stimulusMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
regulation of T cell mediated cytotoxicityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
regulation of adaptive immune responseReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of phosphatase activityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
activation of protein kinase activityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
regulation of type II interferon productionReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
T cell differentiation in thymusReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein modification processReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
non-canonical NF-kappaB signal transductionReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
regulation of apoptotic processReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
T cell homeostasisReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of DNA-templated transcriptionReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
regulation of activated T cell proliferationReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein autophosphorylationReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
lymph node developmentReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
spleen developmentReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
thymus developmentReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
defense response to virusReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of necroptotic processReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
regulation of activation-induced cell death of T cellsReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
necroptotic processReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
cellular response to hydrogen peroxideReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
reactive oxygen species metabolic processReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
apoptotic signaling pathwayReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
programmed necrotic cell deathReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
necroptotic signaling pathwayReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
execution phase of necroptosisReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
amyloid fibril formationReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of reactive oxygen species metabolic processReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
regulation of CD8-positive, alpha-beta cytotoxic T cell extravasationReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
positive regulation of intrinsic apoptotic signaling pathwayReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
signal transductionReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
cytoskeleton organizationSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
establishment or maintenance of cell polaritySerine/threonine-protein kinase MRCK betaHomo sapiens (human)
signal transductionSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
cell migrationSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
actin cytoskeleton organizationSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
actomyosin structure organizationSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
peptidyl-threonine phosphorylationSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
positive regulation of cytokine productionInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of cytokine-mediated signaling pathwayInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
MyD88-dependent toll-like receptor signaling pathwayInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein phosphorylationInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
response to virusInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
positive regulation of macrophage tolerance inductionInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of macrophage cytokine productionInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
cytokine-mediated signaling pathwayInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of NF-kappaB transcription factor activityInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
response to peptidoglycanInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
response to lipopolysaccharideInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of interleukin-12 productionInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of interleukin-6 productionInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of tumor necrosis factor productionInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of toll-like receptor signaling pathwayInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of protein catabolic processInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of protein-containing complex disassemblyInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
regulation of protein-containing complex disassemblyInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
response to exogenous dsRNAInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of MAP kinase activityInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
negative regulation of innate immune responseInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
interleukin-1-mediated signaling pathwayInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
response to interleukin-1Interleukin-1 receptor-associated kinase 3Homo sapiens (human)
Toll signaling pathwayInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
cellular response to lipopolysaccharideInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
intracellular signal transductionInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein phosphorylationSerine/threonine-protein kinase 24Homo sapiens (human)
signal transductionSerine/threonine-protein kinase 24Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to oxidative stressSerine/threonine-protein kinase 24Homo sapiens (human)
cellular response to starvationSerine/threonine-protein kinase 24Homo sapiens (human)
negative regulation of cell migrationSerine/threonine-protein kinase 24Homo sapiens (human)
cellular response to oxidative stressSerine/threonine-protein kinase 24Homo sapiens (human)
protein autophosphorylationSerine/threonine-protein kinase 24Homo sapiens (human)
regulation of axon regenerationSerine/threonine-protein kinase 24Homo sapiens (human)
positive regulation of axon regenerationSerine/threonine-protein kinase 24Homo sapiens (human)
execution phase of apoptosisSerine/threonine-protein kinase 24Homo sapiens (human)
Wnt signaling pathwayCasein kinase I isoform gamma-3Homo sapiens (human)
protein modification processCasein kinase I isoform gamma-3Homo sapiens (human)
peptidyl-serine phosphorylationCasein kinase I isoform gamma-3Homo sapiens (human)
signal transductionCasein kinase I isoform gamma-3Homo sapiens (human)
positive regulation of canonical Wnt signaling pathwayCasein kinase I isoform gamma-3Homo sapiens (human)
endocytosisCasein kinase I isoform gamma-3Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
placenta developmentMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
response to UV-CMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
regulation of gene expressionMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
male germ-line sex determinationMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
positive regulation of JUN kinase activityMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
positive regulation of telomerase activityMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
chorionic trophoblast cell differentiationMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
positive regulation of p38MAPK cascadeMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
positive regulation of telomere cappingMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Molecular Functions (519)

Processvia Protein(s)Taxonomy
protein serine/threonine kinase activityBone morphogenetic protein receptor type-1BHomo sapiens (human)
transmembrane receptor protein serine/threonine kinase activityBone morphogenetic protein receptor type-1BHomo sapiens (human)
transmembrane signaling receptor activityBone morphogenetic protein receptor type-1BHomo sapiens (human)
protein bindingBone morphogenetic protein receptor type-1BHomo sapiens (human)
ATP bindingBone morphogenetic protein receptor type-1BHomo sapiens (human)
BMP bindingBone morphogenetic protein receptor type-1BHomo sapiens (human)
SMAD bindingBone morphogenetic protein receptor type-1BHomo sapiens (human)
metal ion bindingBone morphogenetic protein receptor type-1BHomo sapiens (human)
BMP receptor activityBone morphogenetic protein receptor type-1BHomo sapiens (human)
transforming growth factor beta receptor activity, type IBone morphogenetic protein receptor type-1BHomo sapiens (human)
amyloid-beta bindingMembrane-associated progesterone receptor component 1Homo sapiens (human)
steroid bindingMembrane-associated progesterone receptor component 1Homo sapiens (human)
protein bindingMembrane-associated progesterone receptor component 1Homo sapiens (human)
heme bindingMembrane-associated progesterone receptor component 1Homo sapiens (human)
protein homodimerization activityMembrane-associated progesterone receptor component 1Homo sapiens (human)
metal ion bindingMembrane-associated progesterone receptor component 1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase PLK4Homo sapiens (human)
protein bindingSerine/threonine-protein kinase PLK4Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase PLK4Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase PLK4Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase PLK4Homo sapiens (human)
DNA bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
DNA helicase activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
RNA bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
RNA helicase activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
mRNA bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
GTPase activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
protein bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
ATP bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
transcription factor bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
poly(A) bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
eukaryotic initiation factor 4E bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
ATP hydrolysis activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
ribonucleoside triphosphate phosphatase activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
translation initiation factor bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
RNA strand annealing activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
signaling adaptor activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
RNA stem-loop bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
gamma-tubulin bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
ribosomal small subunit bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
CTPase activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
protein serine/threonine kinase activator activityATP-dependent RNA helicase DDX3XHomo sapiens (human)
cadherin bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
mRNA 5'-UTR bindingATP-dependent RNA helicase DDX3XHomo sapiens (human)
magnesium ion bindingPyridoxal kinaseHomo sapiens (human)
ATP bindingPyridoxal kinaseHomo sapiens (human)
zinc ion bindingPyridoxal kinaseHomo sapiens (human)
pyridoxal kinase activityPyridoxal kinaseHomo sapiens (human)
pyridoxal phosphate bindingPyridoxal kinaseHomo sapiens (human)
potassium ion bindingPyridoxal kinaseHomo sapiens (human)
sodium ion bindingPyridoxal kinaseHomo sapiens (human)
lithium ion bindingPyridoxal kinaseHomo sapiens (human)
protein homodimerization activityPyridoxal kinaseHomo sapiens (human)
transcription coactivator bindingCitron Rho-interacting kinaseHomo sapiens (human)
protein serine/threonine kinase activityCitron Rho-interacting kinaseHomo sapiens (human)
protein bindingCitron Rho-interacting kinaseHomo sapiens (human)
ATP bindingCitron Rho-interacting kinaseHomo sapiens (human)
SH3 domain bindingCitron Rho-interacting kinaseHomo sapiens (human)
protein kinase bindingCitron Rho-interacting kinaseHomo sapiens (human)
PDZ domain bindingCitron Rho-interacting kinaseHomo sapiens (human)
protein serine/threonine kinase inhibitor activityCitron Rho-interacting kinaseHomo sapiens (human)
metal ion bindingCitron Rho-interacting kinaseHomo sapiens (human)
scaffold protein bindingCitron Rho-interacting kinaseHomo sapiens (human)
protein serine kinase activityCitron Rho-interacting kinaseHomo sapiens (human)
protein kinase activitySerine/threonine-protein kinase Chk1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase Chk1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase Chk1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase Chk1Homo sapiens (human)
protein domain specific bindingSerine/threonine-protein kinase Chk1Homo sapiens (human)
histone H3T11 kinase activitySerine/threonine-protein kinase Chk1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase Chk1Homo sapiens (human)
protein kinase activityAurora kinase AHomo sapiens (human)
protein serine/threonine kinase activityAurora kinase AHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityAurora kinase AHomo sapiens (human)
protein bindingAurora kinase AHomo sapiens (human)
ATP bindingAurora kinase AHomo sapiens (human)
protein kinase bindingAurora kinase AHomo sapiens (human)
ubiquitin protein ligase bindingAurora kinase AHomo sapiens (human)
histone H3S10 kinase activityAurora kinase AHomo sapiens (human)
protein heterodimerization activityAurora kinase AHomo sapiens (human)
protein serine kinase activityAurora kinase AHomo sapiens (human)
molecular function activator activityAurora kinase AHomo sapiens (human)
protein serine/threonine kinase activityCyclin-G-associated kinaseHomo sapiens (human)
protein bindingCyclin-G-associated kinaseHomo sapiens (human)
ATP bindingCyclin-G-associated kinaseHomo sapiens (human)
cyclin bindingCyclin-G-associated kinaseHomo sapiens (human)
protein-folding chaperone bindingCyclin-G-associated kinaseHomo sapiens (human)
protein serine kinase activityCyclin-G-associated kinaseHomo sapiens (human)
clathrin bindingCyclin-G-associated kinaseHomo sapiens (human)
ephrin receptor activityEphrin type-B receptor 6Homo sapiens (human)
protein bindingEphrin type-B receptor 6Homo sapiens (human)
ATP bindingEphrin type-B receptor 6Homo sapiens (human)
signaling receptor activityEphrin type-B receptor 6Homo sapiens (human)
transmembrane-ephrin receptor activityEphrin type-B receptor 6Homo sapiens (human)
FAD bindingPeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
flavin adenine dinucleotide bindingPeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
pristanoyl-CoA oxidase activityPeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
fatty acid bindingPeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
protein serine/threonine kinase activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
signaling receptor bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
protein bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
ATP bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
LIM domain bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
signaling adaptor activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
identical protein bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
protein homodimerization activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
CARD domain bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
caspase bindingReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
protein serine kinase activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
JUN kinase kinase kinase activityReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
protein kinase activityMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
protein serine/threonine kinase activityMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
protein bindingMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
ATP bindingMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
protein serine kinase activityMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
histone H2A kinase activityMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
magnesium ion bindingDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
GTPase activityDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
protein bindingDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
GTP bindingDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
phosphatidic acid bindingDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
GTPase-dependent fusogenic activityDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
membrane bending activityDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
cardiolipin bindingDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
microtubule bindingDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
protein kinase activityTyrosine-protein kinase JAK2Homo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase JAK2Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase JAK2Homo sapiens (human)
signaling receptor bindingTyrosine-protein kinase JAK2Homo sapiens (human)
growth hormone receptor bindingTyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-12 receptor bindingTyrosine-protein kinase JAK2Homo sapiens (human)
protein bindingTyrosine-protein kinase JAK2Homo sapiens (human)
ATP bindingTyrosine-protein kinase JAK2Homo sapiens (human)
protein kinase bindingTyrosine-protein kinase JAK2Homo sapiens (human)
heme bindingTyrosine-protein kinase JAK2Homo sapiens (human)
type 1 angiotensin receptor bindingTyrosine-protein kinase JAK2Homo sapiens (human)
acetylcholine receptor bindingTyrosine-protein kinase JAK2Homo sapiens (human)
histone H3Y41 kinase activityTyrosine-protein kinase JAK2Homo sapiens (human)
SH2 domain bindingTyrosine-protein kinase JAK2Homo sapiens (human)
histone bindingTyrosine-protein kinase JAK2Homo sapiens (human)
identical protein bindingTyrosine-protein kinase JAK2Homo sapiens (human)
phosphatidylinositol 3-kinase bindingTyrosine-protein kinase JAK2Homo sapiens (human)
insulin receptor substrate bindingTyrosine-protein kinase JAK2Homo sapiens (human)
metal ion bindingTyrosine-protein kinase JAK2Homo sapiens (human)
peptide hormone receptor bindingTyrosine-protein kinase JAK2Homo sapiens (human)
tRNA bindingEukaryotic translation initiation factor 5BHomo sapiens (human)
RNA bindingEukaryotic translation initiation factor 5BHomo sapiens (human)
translation initiation factor activityEukaryotic translation initiation factor 5BHomo sapiens (human)
GTPase activityEukaryotic translation initiation factor 5BHomo sapiens (human)
protein bindingEukaryotic translation initiation factor 5BHomo sapiens (human)
GTP bindingEukaryotic translation initiation factor 5BHomo sapiens (human)
metal ion bindingEukaryotic translation initiation factor 5BHomo sapiens (human)
protease bindingRho-associated protein kinase 2Homo sapiens (human)
RNA bindingRho-associated protein kinase 2Homo sapiens (human)
protein serine/threonine kinase activityRho-associated protein kinase 2Homo sapiens (human)
structural molecule activityRho-associated protein kinase 2Homo sapiens (human)
protein bindingRho-associated protein kinase 2Homo sapiens (human)
ATP bindingRho-associated protein kinase 2Homo sapiens (human)
small GTPase bindingRho-associated protein kinase 2Homo sapiens (human)
metal ion bindingRho-associated protein kinase 2Homo sapiens (human)
tau protein bindingRho-associated protein kinase 2Homo sapiens (human)
tau-protein kinase activityRho-associated protein kinase 2Homo sapiens (human)
endopeptidase activator activityRho-associated protein kinase 2Homo sapiens (human)
Rho-dependent protein serine/threonine kinase activityRho-associated protein kinase 2Homo sapiens (human)
protein serine kinase activityRho-associated protein kinase 2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase ULK1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase ULK1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase ULK1Homo sapiens (human)
small GTPase bindingSerine/threonine-protein kinase ULK1Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase ULK1Homo sapiens (human)
protein-containing complex bindingSerine/threonine-protein kinase ULK1Homo sapiens (human)
GTPase bindingSerine/threonine-protein kinase ULK1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase ULK1Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
RNA endonuclease activitySerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
platelet-derived growth factor receptor bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
enzyme bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
Hsp70 protein bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
protein homodimerization activitySerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
ADP bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
Hsp90 protein bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
unfolded protein bindingSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
magnesium ion bindingRibosomal protein S6 kinase alpha-5Homo sapiens (human)
protein serine/threonine kinase activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
protein tyrosine kinase activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
protein bindingRibosomal protein S6 kinase alpha-5Homo sapiens (human)
ATP bindingRibosomal protein S6 kinase alpha-5Homo sapiens (human)
histone H3S10 kinase activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
histone H3S28 kinase activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
histone H2AS1 kinase activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
protein serine kinase activityRibosomal protein S6 kinase alpha-5Homo sapiens (human)
RNA bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
RNA helicase activityU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
helicase activityU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
protein bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
ATP bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
ATP hydrolysis activityU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
identical protein bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
magnesium ion bindingRibosomal protein S6 kinase alpha-4Homo sapiens (human)
protein serine/threonine kinase activityRibosomal protein S6 kinase alpha-4Homo sapiens (human)
ribosomal protein S6 kinase activityRibosomal protein S6 kinase alpha-4Homo sapiens (human)
protein bindingRibosomal protein S6 kinase alpha-4Homo sapiens (human)
ATP bindingRibosomal protein S6 kinase alpha-4Homo sapiens (human)
histone H3S10 kinase activityRibosomal protein S6 kinase alpha-4Homo sapiens (human)
histone H3S28 kinase activityRibosomal protein S6 kinase alpha-4Homo sapiens (human)
protein serine kinase activityRibosomal protein S6 kinase alpha-4Homo sapiens (human)
RNA polymerase II cis-regulatory region sequence-specific DNA bindingSerine/threonine-protein kinase 16Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activitySerine/threonine-protein kinase 16Homo sapiens (human)
protein bindingSerine/threonine-protein kinase 16Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase 16Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase 16Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase 16Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase 10Homo sapiens (human)
protein bindingSerine/threonine-protein kinase 10Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase 10Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase 10Homo sapiens (human)
protein homodimerization activitySerine/threonine-protein kinase 10Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase 10Homo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activitySerine/threonine-protein kinase D3Homo sapiens (human)
protein bindingSerine/threonine-protein kinase D3Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase D3Homo sapiens (human)
kinase activitySerine/threonine-protein kinase D3Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase D3Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase D3Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase D3Homo sapiens (human)
single-stranded DNA bindingStructural maintenance of chromosomes protein 2Homo sapiens (human)
protein bindingStructural maintenance of chromosomes protein 2Homo sapiens (human)
ATP bindingStructural maintenance of chromosomes protein 2Homo sapiens (human)
ATP hydrolysis activityStructural maintenance of chromosomes protein 2Homo sapiens (human)
chromatin bindingStructural maintenance of chromosomes protein 2Homo sapiens (human)
magnesium ion bindingMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 6Homo sapiens (human)
creatine kinase activityMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
microtubule bindingMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
MAP kinase kinase kinase kinase activityMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase LATS1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase LATS1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase LATS1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase LATS1Homo sapiens (human)
protein kinase bindingSerine/threonine-protein kinase LATS1Homo sapiens (human)
nuclear estrogen receptor bindingSerine/threonine-protein kinase LATS1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase LATS1Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase PAK 4Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase PAK 4Homo sapiens (human)
protein bindingSerine/threonine-protein kinase PAK 4Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase PAK 4Homo sapiens (human)
cadherin binding involved in cell-cell adhesionSerine/threonine-protein kinase PAK 4Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase PAK 4Homo sapiens (human)
supercoiled DNA bindingTyrosine-protein kinase ABL1Homo sapiens (human)
magnesium ion bindingTyrosine-protein kinase ABL1Homo sapiens (human)
four-way junction DNA bindingTyrosine-protein kinase ABL1Homo sapiens (human)
bubble DNA bindingTyrosine-protein kinase ABL1Homo sapiens (human)
phosphotyrosine residue bindingTyrosine-protein kinase ABL1Homo sapiens (human)
DNA bindingTyrosine-protein kinase ABL1Homo sapiens (human)
transcription coactivator activityTyrosine-protein kinase ABL1Homo sapiens (human)
actin monomer bindingTyrosine-protein kinase ABL1Homo sapiens (human)
nicotinate-nucleotide adenylyltransferase activityTyrosine-protein kinase ABL1Homo sapiens (human)
protein kinase activityTyrosine-protein kinase ABL1Homo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase ABL1Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase ABL1Homo sapiens (human)
protein kinase C bindingTyrosine-protein kinase ABL1Homo sapiens (human)
protein bindingTyrosine-protein kinase ABL1Homo sapiens (human)
ATP bindingTyrosine-protein kinase ABL1Homo sapiens (human)
kinase activityTyrosine-protein kinase ABL1Homo sapiens (human)
SH3 domain bindingTyrosine-protein kinase ABL1Homo sapiens (human)
syntaxin bindingTyrosine-protein kinase ABL1Homo sapiens (human)
manganese ion bindingTyrosine-protein kinase ABL1Homo sapiens (human)
neuropilin bindingTyrosine-protein kinase ABL1Homo sapiens (human)
SH2 domain bindingTyrosine-protein kinase ABL1Homo sapiens (human)
ephrin receptor bindingTyrosine-protein kinase ABL1Homo sapiens (human)
actin filament bindingTyrosine-protein kinase ABL1Homo sapiens (human)
mitogen-activated protein kinase bindingTyrosine-protein kinase ABL1Homo sapiens (human)
proline-rich region bindingTyrosine-protein kinase ABL1Homo sapiens (human)
delta-catenin bindingTyrosine-protein kinase ABL1Homo sapiens (human)
sequence-specific double-stranded DNA bindingTyrosine-protein kinase ABL1Homo sapiens (human)
epidermal growth factor receptor activityEpidermal growth factor receptorHomo sapiens (human)
virus receptor activityEpidermal growth factor receptorHomo sapiens (human)
chromatin bindingEpidermal growth factor receptorHomo sapiens (human)
double-stranded DNA bindingEpidermal growth factor receptorHomo sapiens (human)
MAP kinase kinase kinase activityEpidermal growth factor receptorHomo sapiens (human)
protein tyrosine kinase activityEpidermal growth factor receptorHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activityEpidermal growth factor receptorHomo sapiens (human)
transmembrane signaling receptor activityEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor receptor activityEpidermal growth factor receptorHomo sapiens (human)
integrin bindingEpidermal growth factor receptorHomo sapiens (human)
protein bindingEpidermal growth factor receptorHomo sapiens (human)
calmodulin bindingEpidermal growth factor receptorHomo sapiens (human)
ATP bindingEpidermal growth factor receptorHomo sapiens (human)
enzyme bindingEpidermal growth factor receptorHomo sapiens (human)
kinase bindingEpidermal growth factor receptorHomo sapiens (human)
protein kinase bindingEpidermal growth factor receptorHomo sapiens (human)
protein phosphatase bindingEpidermal growth factor receptorHomo sapiens (human)
protein tyrosine kinase activator activityEpidermal growth factor receptorHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activator activityEpidermal growth factor receptorHomo sapiens (human)
ubiquitin protein ligase bindingEpidermal growth factor receptorHomo sapiens (human)
identical protein bindingEpidermal growth factor receptorHomo sapiens (human)
cadherin bindingEpidermal growth factor receptorHomo sapiens (human)
actin filament bindingEpidermal growth factor receptorHomo sapiens (human)
ATPase bindingEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor bindingEpidermal growth factor receptorHomo sapiens (human)
cytokine activityInterferon betaHomo sapiens (human)
cytokine receptor bindingInterferon betaHomo sapiens (human)
type I interferon receptor bindingInterferon betaHomo sapiens (human)
protein bindingInterferon betaHomo sapiens (human)
chloramphenicol O-acetyltransferase activityInterferon betaHomo sapiens (human)
protein tyrosine kinase activityHigh affinity nerve growth factor receptorHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activityHigh affinity nerve growth factor receptorHomo sapiens (human)
GPI-linked ephrin receptor activityHigh affinity nerve growth factor receptorHomo sapiens (human)
neurotrophin p75 receptor bindingHigh affinity nerve growth factor receptorHomo sapiens (human)
protein bindingHigh affinity nerve growth factor receptorHomo sapiens (human)
ATP bindingHigh affinity nerve growth factor receptorHomo sapiens (human)
nerve growth factor receptor activityHigh affinity nerve growth factor receptorHomo sapiens (human)
kinase bindingHigh affinity nerve growth factor receptorHomo sapiens (human)
identical protein bindingHigh affinity nerve growth factor receptorHomo sapiens (human)
protein homodimerization activityHigh affinity nerve growth factor receptorHomo sapiens (human)
nerve growth factor bindingHigh affinity nerve growth factor receptorHomo sapiens (human)
neurotrophin bindingHigh affinity nerve growth factor receptorHomo sapiens (human)
neurotrophin receptor activityHigh affinity nerve growth factor receptorHomo sapiens (human)
adenine nucleotide transmembrane transporter activityADP/ATP translocase 2Homo sapiens (human)
RNA bindingADP/ATP translocase 2Homo sapiens (human)
ATP:ADP antiporter activityADP/ATP translocase 2Homo sapiens (human)
protein bindingADP/ATP translocase 2Homo sapiens (human)
proton transmembrane transporter activityADP/ATP translocase 2Homo sapiens (human)
adenine transmembrane transporter activityADP/ATP translocase 2Homo sapiens (human)
oxidative phosphorylation uncoupler activityADP/ATP translocase 2Homo sapiens (human)
ubiquitin protein ligase bindingADP/ATP translocase 2Homo sapiens (human)
monooxygenase activityCytochrome P450 1A2Homo sapiens (human)
iron ion bindingCytochrome P450 1A2Homo sapiens (human)
protein bindingCytochrome P450 1A2Homo sapiens (human)
electron transfer activityCytochrome P450 1A2Homo sapiens (human)
oxidoreductase activityCytochrome P450 1A2Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenCytochrome P450 1A2Homo sapiens (human)
enzyme bindingCytochrome P450 1A2Homo sapiens (human)
heme bindingCytochrome P450 1A2Homo sapiens (human)
demethylase activityCytochrome P450 1A2Homo sapiens (human)
caffeine oxidase activityCytochrome P450 1A2Homo sapiens (human)
aromatase activityCytochrome P450 1A2Homo sapiens (human)
estrogen 16-alpha-hydroxylase activityCytochrome P450 1A2Homo sapiens (human)
estrogen 2-hydroxylase activityCytochrome P450 1A2Homo sapiens (human)
hydroperoxy icosatetraenoate dehydratase activityCytochrome P450 1A2Homo sapiens (human)
monooxygenase activityCytochrome P450 2E1Homo sapiens (human)
iron ion bindingCytochrome P450 2E1Homo sapiens (human)
oxidoreductase activityCytochrome P450 2E1Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygenCytochrome P450 2E1Homo sapiens (human)
4-nitrophenol 2-monooxygenase activityCytochrome P450 2E1Homo sapiens (human)
oxygen bindingCytochrome P450 2E1Homo sapiens (human)
enzyme bindingCytochrome P450 2E1Homo sapiens (human)
heme bindingCytochrome P450 2E1Homo sapiens (human)
Hsp70 protein bindingCytochrome P450 2E1Homo sapiens (human)
Hsp90 protein bindingCytochrome P450 2E1Homo sapiens (human)
aromatase activityCytochrome P450 2E1Homo sapiens (human)
long-chain fatty acid omega-1 hydroxylase activityCytochrome P450 2E1Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenCytochrome P450 2E1Homo sapiens (human)
arachidonic acid epoxygenase activityCytochrome P450 2E1Homo sapiens (human)
chromatin bindingProtein kinase C beta typeHomo sapiens (human)
protein serine/threonine kinase activityProtein kinase C beta typeHomo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activityProtein kinase C beta typeHomo sapiens (human)
protein kinase C bindingProtein kinase C beta typeHomo sapiens (human)
calcium channel regulator activityProtein kinase C beta typeHomo sapiens (human)
protein bindingProtein kinase C beta typeHomo sapiens (human)
ATP bindingProtein kinase C beta typeHomo sapiens (human)
zinc ion bindingProtein kinase C beta typeHomo sapiens (human)
nuclear receptor coactivator activityProtein kinase C beta typeHomo sapiens (human)
histone H3T6 kinase activityProtein kinase C beta typeHomo sapiens (human)
histone bindingProtein kinase C beta typeHomo sapiens (human)
nuclear androgen receptor bindingProtein kinase C beta typeHomo sapiens (human)
protein serine kinase activityProtein kinase C beta typeHomo sapiens (human)
amyloid-beta bindingInsulin receptorHomo sapiens (human)
protein tyrosine kinase activityInsulin receptorHomo sapiens (human)
insulin receptor activityInsulin receptorHomo sapiens (human)
insulin-like growth factor receptor bindingInsulin receptorHomo sapiens (human)
protein bindingInsulin receptorHomo sapiens (human)
ATP bindingInsulin receptorHomo sapiens (human)
GTP bindingInsulin receptorHomo sapiens (human)
protein domain specific bindingInsulin receptorHomo sapiens (human)
insulin-like growth factor I bindingInsulin receptorHomo sapiens (human)
insulin-like growth factor II bindingInsulin receptorHomo sapiens (human)
cargo receptor activityInsulin receptorHomo sapiens (human)
phosphatidylinositol 3-kinase bindingInsulin receptorHomo sapiens (human)
insulin bindingInsulin receptorHomo sapiens (human)
insulin receptor substrate bindingInsulin receptorHomo sapiens (human)
protein-containing complex bindingInsulin receptorHomo sapiens (human)
PTB domain bindingInsulin receptorHomo sapiens (human)
phosphotyrosine residue bindingTyrosine-protein kinase LckHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase LckHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase LckHomo sapiens (human)
protein serine/threonine phosphatase activityTyrosine-protein kinase LckHomo sapiens (human)
protein bindingTyrosine-protein kinase LckHomo sapiens (human)
ATP bindingTyrosine-protein kinase LckHomo sapiens (human)
phospholipase activator activityTyrosine-protein kinase LckHomo sapiens (human)
protein kinase bindingTyrosine-protein kinase LckHomo sapiens (human)
protein phosphatase bindingTyrosine-protein kinase LckHomo sapiens (human)
SH2 domain bindingTyrosine-protein kinase LckHomo sapiens (human)
T cell receptor bindingTyrosine-protein kinase LckHomo sapiens (human)
CD4 receptor bindingTyrosine-protein kinase LckHomo sapiens (human)
CD8 receptor bindingTyrosine-protein kinase LckHomo sapiens (human)
identical protein bindingTyrosine-protein kinase LckHomo sapiens (human)
phospholipase bindingTyrosine-protein kinase LckHomo sapiens (human)
phosphatidylinositol 3-kinase bindingTyrosine-protein kinase LckHomo sapiens (human)
ATPase bindingTyrosine-protein kinase LckHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase LckHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase FynHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase FynHomo sapiens (human)
protein bindingTyrosine-protein kinase FynHomo sapiens (human)
ATP bindingTyrosine-protein kinase FynHomo sapiens (human)
phospholipase activator activityTyrosine-protein kinase FynHomo sapiens (human)
enzyme bindingTyrosine-protein kinase FynHomo sapiens (human)
type 5 metabotropic glutamate receptor bindingTyrosine-protein kinase FynHomo sapiens (human)
identical protein bindingTyrosine-protein kinase FynHomo sapiens (human)
alpha-tubulin bindingTyrosine-protein kinase FynHomo sapiens (human)
phospholipase bindingTyrosine-protein kinase FynHomo sapiens (human)
transmembrane transporter bindingTyrosine-protein kinase FynHomo sapiens (human)
metal ion bindingTyrosine-protein kinase FynHomo sapiens (human)
ephrin receptor bindingTyrosine-protein kinase FynHomo sapiens (human)
tau protein bindingTyrosine-protein kinase FynHomo sapiens (human)
tau-protein kinase activityTyrosine-protein kinase FynHomo sapiens (human)
growth factor receptor bindingTyrosine-protein kinase FynHomo sapiens (human)
scaffold protein bindingTyrosine-protein kinase FynHomo sapiens (human)
disordered domain specific bindingTyrosine-protein kinase FynHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase FynHomo sapiens (human)
virus receptor activityCyclin-dependent kinase 1Homo sapiens (human)
chromatin bindingCyclin-dependent kinase 1Homo sapiens (human)
protein kinase activityCyclin-dependent kinase 1Homo sapiens (human)
protein serine/threonine kinase activityCyclin-dependent kinase 1Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 1Homo sapiens (human)
protein bindingCyclin-dependent kinase 1Homo sapiens (human)
ATP bindingCyclin-dependent kinase 1Homo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityCyclin-dependent kinase 1Homo sapiens (human)
kinase activityCyclin-dependent kinase 1Homo sapiens (human)
cyclin bindingCyclin-dependent kinase 1Homo sapiens (human)
Hsp70 protein bindingCyclin-dependent kinase 1Homo sapiens (human)
histone kinase activityCyclin-dependent kinase 1Homo sapiens (human)
cyclin-dependent protein kinase activityCyclin-dependent kinase 1Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 1Homo sapiens (human)
purine nucleobase bindingGlycogen phosphorylase, liver formHomo sapiens (human)
protein bindingGlycogen phosphorylase, liver formHomo sapiens (human)
ATP bindingGlycogen phosphorylase, liver formHomo sapiens (human)
glucose bindingGlycogen phosphorylase, liver formHomo sapiens (human)
glycogen phosphorylase activityGlycogen phosphorylase, liver formHomo sapiens (human)
AMP bindingGlycogen phosphorylase, liver formHomo sapiens (human)
vitamin bindingGlycogen phosphorylase, liver formHomo sapiens (human)
bile acid bindingGlycogen phosphorylase, liver formHomo sapiens (human)
identical protein bindingGlycogen phosphorylase, liver formHomo sapiens (human)
linear malto-oligosaccharide phosphorylase activityGlycogen phosphorylase, liver formHomo sapiens (human)
SHG alpha-glucan phosphorylase activityGlycogen phosphorylase, liver formHomo sapiens (human)
pyridoxal phosphate bindingGlycogen phosphorylase, liver formHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase Fes/FpsHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase Fes/FpsHomo sapiens (human)
protein bindingTyrosine-protein kinase Fes/FpsHomo sapiens (human)
ATP bindingTyrosine-protein kinase Fes/FpsHomo sapiens (human)
microtubule bindingTyrosine-protein kinase Fes/FpsHomo sapiens (human)
immunoglobulin receptor bindingTyrosine-protein kinase Fes/FpsHomo sapiens (human)
phosphatidylinositol bindingTyrosine-protein kinase Fes/FpsHomo sapiens (human)
protein tyrosine kinase activityMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
macrophage colony-stimulating factor receptor activityMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
protein bindingMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
ATP bindingMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
protein phosphatase bindingMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cytokine bindingMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
protein homodimerization activityMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
growth factor bindingMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
adenine phosphoribosyltransferase activityAdenine phosphoribosyltransferaseHomo sapiens (human)
protein bindingAdenine phosphoribosyltransferaseHomo sapiens (human)
AMP bindingAdenine phosphoribosyltransferaseHomo sapiens (human)
adenine bindingAdenine phosphoribosyltransferaseHomo sapiens (human)
phosphotyrosine residue bindingTyrosine-protein kinase YesHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase YesHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase YesHomo sapiens (human)
protein bindingTyrosine-protein kinase YesHomo sapiens (human)
ATP bindingTyrosine-protein kinase YesHomo sapiens (human)
enzyme bindingTyrosine-protein kinase YesHomo sapiens (human)
transmembrane transporter bindingTyrosine-protein kinase YesHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase YesHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase LynHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase LynHomo sapiens (human)
platelet-derived growth factor receptor bindingTyrosine-protein kinase LynHomo sapiens (human)
integrin bindingTyrosine-protein kinase LynHomo sapiens (human)
protein bindingTyrosine-protein kinase LynHomo sapiens (human)
ATP bindingTyrosine-protein kinase LynHomo sapiens (human)
kinase activityTyrosine-protein kinase LynHomo sapiens (human)
SH3 domain bindingTyrosine-protein kinase LynHomo sapiens (human)
ubiquitin protein ligase bindingTyrosine-protein kinase LynHomo sapiens (human)
gamma-tubulin bindingTyrosine-protein kinase LynHomo sapiens (human)
glycosphingolipid bindingTyrosine-protein kinase LynHomo sapiens (human)
transmembrane transporter bindingTyrosine-protein kinase LynHomo sapiens (human)
ephrin receptor bindingTyrosine-protein kinase LynHomo sapiens (human)
phosphoprotein bindingTyrosine-protein kinase LynHomo sapiens (human)
scaffold protein bindingTyrosine-protein kinase LynHomo sapiens (human)
phosphorylation-dependent protein bindingTyrosine-protein kinase LynHomo sapiens (human)
phosphatidylinositol 3-kinase activator activityTyrosine-protein kinase LynHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase LynHomo sapiens (human)
protein tyrosine kinase activityProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activityProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
calcium ion bindingProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
protein bindingProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
ATP bindingProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
signaling receptor activityProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
G-protein alpha-subunit bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
protein tyrosine kinase activityInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin-like growth factor receptor activityInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin receptor bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
protein bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin-like growth factor bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
ATP bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin-like growth factor I bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
identical protein bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
phosphatidylinositol 3-kinase bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin receptor substrate bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
protein-containing complex bindingInsulin-like growth factor 1 receptorHomo sapiens (human)
protein transporter activityInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin receptor activityInsulin-like growth factor 1 receptorHomo sapiens (human)
RNA bindingSignal recognition particle receptor subunit alphaHomo sapiens (human)
GTP bindingSignal recognition particle receptor subunit alphaHomo sapiens (human)
ATP hydrolysis activitySignal recognition particle receptor subunit alphaHomo sapiens (human)
signal recognition particle bindingSignal recognition particle receptor subunit alphaHomo sapiens (human)
GTPase activitySignal recognition particle receptor subunit alphaHomo sapiens (human)
protein bindingCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
ubiquinol-cytochrome-c reductase activityCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
heme bindingCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
metal ion bindingCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
protein tyrosine kinase activityHepatocyte growth factor receptorHomo sapiens (human)
protein bindingHepatocyte growth factor receptorHomo sapiens (human)
ATP bindingHepatocyte growth factor receptorHomo sapiens (human)
semaphorin receptor activityHepatocyte growth factor receptorHomo sapiens (human)
protein phosphatase bindingHepatocyte growth factor receptorHomo sapiens (human)
identical protein bindingHepatocyte growth factor receptorHomo sapiens (human)
molecular function activator activityHepatocyte growth factor receptorHomo sapiens (human)
hepatocyte growth factor receptor activityHepatocyte growth factor receptorHomo sapiens (human)
phosphotyrosine residue bindingTyrosine-protein kinase HCKHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase HCKHomo sapiens (human)
protein bindingTyrosine-protein kinase HCKHomo sapiens (human)
ATP bindingTyrosine-protein kinase HCKHomo sapiens (human)
lipid bindingTyrosine-protein kinase HCKHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase HCKHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase HCKHomo sapiens (human)
monooxygenase activityCytochrome P450 3A4Homo sapiens (human)
steroid bindingCytochrome P450 3A4Homo sapiens (human)
iron ion bindingCytochrome P450 3A4Homo sapiens (human)
protein bindingCytochrome P450 3A4Homo sapiens (human)
steroid hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
retinoic acid 4-hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
oxidoreductase activityCytochrome P450 3A4Homo sapiens (human)
oxygen bindingCytochrome P450 3A4Homo sapiens (human)
enzyme bindingCytochrome P450 3A4Homo sapiens (human)
heme bindingCytochrome P450 3A4Homo sapiens (human)
vitamin D3 25-hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
caffeine oxidase activityCytochrome P450 3A4Homo sapiens (human)
quinine 3-monooxygenase activityCytochrome P450 3A4Homo sapiens (human)
testosterone 6-beta-hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
anandamide 8,9 epoxidase activityCytochrome P450 3A4Homo sapiens (human)
anandamide 11,12 epoxidase activityCytochrome P450 3A4Homo sapiens (human)
anandamide 14,15 epoxidase activityCytochrome P450 3A4Homo sapiens (human)
aromatase activityCytochrome P450 3A4Homo sapiens (human)
vitamin D 24-hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
estrogen 16-alpha-hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
estrogen 2-hydroxylase activityCytochrome P450 3A4Homo sapiens (human)
1,8-cineole 2-exo-monooxygenase activityCytochrome P450 3A4Homo sapiens (human)
protein kinase activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
protein tyrosine kinase activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
platelet activating factor receptor activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
platelet-derived growth factor receptor activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
platelet-derived growth factor beta-receptor activityPlatelet-derived growth factor receptor betaHomo sapiens (human)
signaling receptor bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
platelet-derived growth factor receptor bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
protein bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
ATP bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
enzyme bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
protein kinase bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
vascular endothelial growth factor bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
platelet-derived growth factor bindingPlatelet-derived growth factor receptor betaHomo sapiens (human)
protein kinase activitySerine/threonine-protein kinase A-RafHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase A-RafHomo sapiens (human)
protein bindingSerine/threonine-protein kinase A-RafHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase A-RafHomo sapiens (human)
metal ion bindingSerine/threonine-protein kinase A-RafHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase A-RafHomo sapiens (human)
MAP kinase kinase kinase activitySerine/threonine-protein kinase A-RafHomo sapiens (human)
monooxygenase activityCytochrome P450 2C8Homo sapiens (human)
iron ion bindingCytochrome P450 2C8Homo sapiens (human)
protein bindingCytochrome P450 2C8Homo sapiens (human)
arachidonic acid epoxygenase activityCytochrome P450 2C8Homo sapiens (human)
retinoic acid 4-hydroxylase activityCytochrome P450 2C8Homo sapiens (human)
caffeine oxidase activityCytochrome P450 2C8Homo sapiens (human)
aromatase activityCytochrome P450 2C8Homo sapiens (human)
estrogen 16-alpha-hydroxylase activityCytochrome P450 2C8Homo sapiens (human)
heme bindingCytochrome P450 2C8Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenCytochrome P450 2C8Homo sapiens (human)
monooxygenase activityCytochrome P450 2D6Homo sapiens (human)
iron ion bindingCytochrome P450 2D6Homo sapiens (human)
oxidoreductase activityCytochrome P450 2D6Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenCytochrome P450 2D6Homo sapiens (human)
heme bindingCytochrome P450 2D6Homo sapiens (human)
anandamide 8,9 epoxidase activityCytochrome P450 2D6Homo sapiens (human)
anandamide 11,12 epoxidase activityCytochrome P450 2D6Homo sapiens (human)
anandamide 14,15 epoxidase activityCytochrome P450 2D6Homo sapiens (human)
protein bindingGlycogen phosphorylase, brain formHomo sapiens (human)
glycogen phosphorylase activityGlycogen phosphorylase, brain formHomo sapiens (human)
linear malto-oligosaccharide phosphorylase activityGlycogen phosphorylase, brain formHomo sapiens (human)
SHG alpha-glucan phosphorylase activityGlycogen phosphorylase, brain formHomo sapiens (human)
pyridoxal phosphate bindingGlycogen phosphorylase, brain formHomo sapiens (human)
protein serine/threonine kinase activityBreakpoint cluster region proteinHomo sapiens (human)
protein tyrosine kinase activityBreakpoint cluster region proteinHomo sapiens (human)
guanyl-nucleotide exchange factor activityBreakpoint cluster region proteinHomo sapiens (human)
GTPase activator activityBreakpoint cluster region proteinHomo sapiens (human)
protein bindingBreakpoint cluster region proteinHomo sapiens (human)
ATP bindingBreakpoint cluster region proteinHomo sapiens (human)
protein serine kinase activityBreakpoint cluster region proteinHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase pim-1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase pim-1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase pim-1Homo sapiens (human)
transcription factor bindingSerine/threonine-protein kinase pim-1Homo sapiens (human)
manganese ion bindingSerine/threonine-protein kinase pim-1Homo sapiens (human)
ribosomal small subunit bindingSerine/threonine-protein kinase pim-1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase pim-1Homo sapiens (human)
protein tyrosine kinase activityFibroblast growth factor receptor 1Homo sapiens (human)
fibroblast growth factor receptor activityFibroblast growth factor receptor 1Homo sapiens (human)
protein bindingFibroblast growth factor receptor 1Homo sapiens (human)
ATP bindingFibroblast growth factor receptor 1Homo sapiens (human)
heparin bindingFibroblast growth factor receptor 1Homo sapiens (human)
fibroblast growth factor bindingFibroblast growth factor receptor 1Homo sapiens (human)
SH2 domain bindingFibroblast growth factor receptor 1Homo sapiens (human)
identical protein bindingFibroblast growth factor receptor 1Homo sapiens (human)
protein homodimerization activityFibroblast growth factor receptor 1Homo sapiens (human)
receptor-receptor interactionFibroblast growth factor receptor 1Homo sapiens (human)
monooxygenase activityCytochrome P450 2C9 Homo sapiens (human)
iron ion bindingCytochrome P450 2C9 Homo sapiens (human)
arachidonic acid epoxygenase activityCytochrome P450 2C9 Homo sapiens (human)
steroid hydroxylase activityCytochrome P450 2C9 Homo sapiens (human)
arachidonic acid 14,15-epoxygenase activityCytochrome P450 2C9 Homo sapiens (human)
arachidonic acid 11,12-epoxygenase activityCytochrome P450 2C9 Homo sapiens (human)
oxidoreductase activityCytochrome P450 2C9 Homo sapiens (human)
(S)-limonene 6-monooxygenase activityCytochrome P450 2C9 Homo sapiens (human)
(S)-limonene 7-monooxygenase activityCytochrome P450 2C9 Homo sapiens (human)
caffeine oxidase activityCytochrome P450 2C9 Homo sapiens (human)
(R)-limonene 6-monooxygenase activityCytochrome P450 2C9 Homo sapiens (human)
aromatase activityCytochrome P450 2C9 Homo sapiens (human)
heme bindingCytochrome P450 2C9 Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenCytochrome P450 2C9 Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 4Homo sapiens (human)
protein bindingCyclin-dependent kinase 4Homo sapiens (human)
ATP bindingCyclin-dependent kinase 4Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase regulator activityCyclin-dependent kinase 4Homo sapiens (human)
cyclin bindingCyclin-dependent kinase 4Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 4Homo sapiens (human)
ATP:ADP antiporter activityADP/ATP translocase 3Homo sapiens (human)
protein bindingADP/ATP translocase 3Homo sapiens (human)
nucleotide bindingInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
DNA bindingInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
RNA bindingInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
IMP dehydrogenase activityInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
protein bindingInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
metal ion bindingInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
protein kinase activityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
protein tyrosine kinase activityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
protein kinase C bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
signaling receptor bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
insulin receptor bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
integrin bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
protein bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
ATP bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
phospholipase activator activityProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
enzyme bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
heme bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
nuclear estrogen receptor bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
SH2 domain bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
phospholipase bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
transmembrane transporter bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cadherin bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
ephrin receptor bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
ATPase bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
phosphoprotein bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
BMP receptor bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
connexin bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
scaffold protein bindingProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cAMP-dependent protein kinase inhibitor activitycAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
protein bindingcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
cAMP-dependent protein kinase regulator activitycAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
protein domain specific bindingcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
ubiquitin protein ligase bindingcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
protein kinase A catalytic subunit bindingcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
cAMP bindingcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
small GTPase bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
protein kinase activitySerine/threonine-protein kinase B-rafHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase B-rafHomo sapiens (human)
MAP kinase kinase activitySerine/threonine-protein kinase B-rafHomo sapiens (human)
calcium ion bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
protein bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
mitogen-activated protein kinase kinase bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
identical protein bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
protein-containing complex bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
scaffold protein bindingSerine/threonine-protein kinase B-rafHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase B-rafHomo sapiens (human)
MAP kinase kinase kinase activitySerine/threonine-protein kinase B-rafHomo sapiens (human)
protein serine/threonine kinase activityPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
phosphorylase kinase activityPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
protein bindingPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
calmodulin bindingPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
ATP bindingPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
enzyme bindingPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
tau-protein kinase activityPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
dihydronicotinamide riboside quinone reductase activityRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
protein bindingRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
zinc ion bindingRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
electron transfer activityRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
oxidoreductase activityRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
oxidoreductase activity, acting on other nitrogenous compounds as donorsRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
chloride ion bindingRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
protein homodimerization activityRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
FAD bindingRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
melatonin bindingRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
resveratrol bindingRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
NAD(P)H dehydrogenase (quinone) activityRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase FerHomo sapiens (human)
epidermal growth factor receptor bindingTyrosine-protein kinase FerHomo sapiens (human)
protein bindingTyrosine-protein kinase FerHomo sapiens (human)
ATP bindingTyrosine-protein kinase FerHomo sapiens (human)
protein phosphatase 1 bindingTyrosine-protein kinase FerHomo sapiens (human)
lipid bindingTyrosine-protein kinase FerHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase FerHomo sapiens (human)
protein kinase activityProtein kinase C alpha typeHomo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activityProtein kinase C alpha typeHomo sapiens (human)
calcium,diacylglycerol-dependent serine/threonine kinase activityProtein kinase C alpha typeHomo sapiens (human)
integrin bindingProtein kinase C alpha typeHomo sapiens (human)
protein bindingProtein kinase C alpha typeHomo sapiens (human)
ATP bindingProtein kinase C alpha typeHomo sapiens (human)
zinc ion bindingProtein kinase C alpha typeHomo sapiens (human)
enzyme bindingProtein kinase C alpha typeHomo sapiens (human)
histone H3T6 kinase activityProtein kinase C alpha typeHomo sapiens (human)
protein serine kinase activityProtein kinase C alpha typeHomo sapiens (human)
protein serine/threonine kinase activityProtein kinase C alpha typeHomo sapiens (human)
diacylglycerol bindingProtein kinase C alpha typeHomo sapiens (human)
magnesium ion bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein kinase activitycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein serine/threonine kinase activitycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
AMP-activated protein kinase activitycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cAMP-dependent protein kinase activitycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein serine/threonine/tyrosine kinase activitycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
ATP bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein kinase bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein domain specific bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
manganese ion bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
ubiquitin protein ligase bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein kinase A regulatory subunit bindingcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
channel activator activitycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein serine kinase activitycAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
protein bindingGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
ATP bindingGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
ATP hydrolysis activityGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
protein-macromolecule adaptor activityGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
5'-3' DNA helicase activityGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
metal ion bindingGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
4 iron, 4 sulfur cluster bindingGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
DNA helicase activityGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
damaged DNA bindingGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
protein serine/threonine kinase activityCasein kinase II subunit alpha'Homo sapiens (human)
protein bindingCasein kinase II subunit alpha'Homo sapiens (human)
ATP bindingCasein kinase II subunit alpha'Homo sapiens (human)
protein serine kinase activityCasein kinase II subunit alpha'Homo sapiens (human)
GTPase activityRas-related protein Rab-6AHomo sapiens (human)
protein bindingRas-related protein Rab-6AHomo sapiens (human)
GTP bindingRas-related protein Rab-6AHomo sapiens (human)
protein domain specific bindingRas-related protein Rab-6AHomo sapiens (human)
myosin V bindingRas-related protein Rab-6AHomo sapiens (human)
monooxygenase activityCytochrome P450 2B6Homo sapiens (human)
iron ion bindingCytochrome P450 2B6Homo sapiens (human)
testosterone 16-alpha-hydroxylase activityCytochrome P450 2B6Homo sapiens (human)
heme bindingCytochrome P450 2B6Homo sapiens (human)
testosterone 16-beta-hydroxylase activityCytochrome P450 2B6Homo sapiens (human)
anandamide 8,9 epoxidase activityCytochrome P450 2B6Homo sapiens (human)
anandamide 11,12 epoxidase activityCytochrome P450 2B6Homo sapiens (human)
anandamide 14,15 epoxidase activityCytochrome P450 2B6Homo sapiens (human)
estrogen 2-hydroxylase activityCytochrome P450 2B6Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenCytochrome P450 2B6Homo sapiens (human)
arachidonic acid epoxygenase activityCytochrome P450 2B6Homo sapiens (human)
fibronectin bindingEphrin type-A receptor 1Homo sapiens (human)
protein kinase activityEphrin type-A receptor 1Homo sapiens (human)
transmembrane-ephrin receptor activityEphrin type-A receptor 1Homo sapiens (human)
ATP bindingEphrin type-A receptor 1Homo sapiens (human)
protein kinase bindingEphrin type-A receptor 1Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityEphrin type-A receptor 1Homo sapiens (human)
phosphoribosylaminoimidazole carboxylase activityMultifunctional protein ADE2Homo sapiens (human)
phosphoribosylaminoimidazolesuccinocarboxamide synthase activityMultifunctional protein ADE2Homo sapiens (human)
protein bindingMultifunctional protein ADE2Homo sapiens (human)
ATP bindingMultifunctional protein ADE2Homo sapiens (human)
identical protein bindingMultifunctional protein ADE2Homo sapiens (human)
5-amino-4-imidazole carboxylate lyase activityMultifunctional protein ADE2Homo sapiens (human)
cadherin bindingMultifunctional protein ADE2Homo sapiens (human)
protein serine/threonine kinase activitycAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
AMP-activated protein kinase activitycAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
cAMP-dependent protein kinase activitycAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
protein bindingcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
ATP bindingcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
protein serine kinase activitycAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
protein kinase A regulatory subunit bindingcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
magnesium ion bindingcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
protein serine/threonine kinase activitycAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
AMP-activated protein kinase activitycAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
cAMP-dependent protein kinase activitycAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
protein bindingcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
ATP bindingcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
ubiquitin protein ligase bindingcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
protein serine kinase activitycAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
ferrochelatase activityFerrochelatase, mitochondrialHomo sapiens (human)
protein bindingFerrochelatase, mitochondrialHomo sapiens (human)
ferrous iron bindingFerrochelatase, mitochondrialHomo sapiens (human)
heme bindingFerrochelatase, mitochondrialHomo sapiens (human)
iron-responsive element bindingFerrochelatase, mitochondrialHomo sapiens (human)
identical protein bindingFerrochelatase, mitochondrialHomo sapiens (human)
protein homodimerization activityFerrochelatase, mitochondrialHomo sapiens (human)
2 iron, 2 sulfur cluster bindingFerrochelatase, mitochondrialHomo sapiens (human)
protein kinase activityRibosomal protein S6 kinase beta-1Homo sapiens (human)
protein serine/threonine kinase activityRibosomal protein S6 kinase beta-1Homo sapiens (human)
ribosomal protein S6 kinase activityRibosomal protein S6 kinase beta-1Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityRibosomal protein S6 kinase beta-1Homo sapiens (human)
protein bindingRibosomal protein S6 kinase beta-1Homo sapiens (human)
ATP bindingRibosomal protein S6 kinase beta-1Homo sapiens (human)
PDZ domain bindingRibosomal protein S6 kinase beta-1Homo sapiens (human)
peptide bindingRibosomal protein S6 kinase beta-1Homo sapiens (human)
identical protein bindingRibosomal protein S6 kinase beta-1Homo sapiens (human)
protein phosphatase 2A bindingRibosomal protein S6 kinase beta-1Homo sapiens (human)
protein serine kinase activityRibosomal protein S6 kinase beta-1Homo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase JAK1Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase JAK1Homo sapiens (human)
growth hormone receptor bindingTyrosine-protein kinase JAK1Homo sapiens (human)
protein bindingTyrosine-protein kinase JAK1Homo sapiens (human)
ATP bindingTyrosine-protein kinase JAK1Homo sapiens (human)
protein phosphatase bindingTyrosine-protein kinase JAK1Homo sapiens (human)
ubiquitin protein ligase bindingTyrosine-protein kinase JAK1Homo sapiens (human)
CCR5 chemokine receptor bindingTyrosine-protein kinase JAK1Homo sapiens (human)
metal ion bindingTyrosine-protein kinase JAK1Homo sapiens (human)
histone kinase activityCyclin-dependent kinase 2Homo sapiens (human)
magnesium ion bindingCyclin-dependent kinase 2Homo sapiens (human)
protein serine/threonine kinase activityCyclin-dependent kinase 2Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 2Homo sapiens (human)
protein bindingCyclin-dependent kinase 2Homo sapiens (human)
ATP bindingCyclin-dependent kinase 2Homo sapiens (human)
protein domain specific bindingCyclin-dependent kinase 2Homo sapiens (human)
cyclin bindingCyclin-dependent kinase 2Homo sapiens (human)
cyclin-dependent protein kinase activityCyclin-dependent kinase 2Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 2Homo sapiens (human)
protein kinase activityBeta-adrenergic receptor kinase 1Homo sapiens (human)
G protein-coupled receptor kinase activityBeta-adrenergic receptor kinase 1Homo sapiens (human)
protein bindingBeta-adrenergic receptor kinase 1Homo sapiens (human)
ATP bindingBeta-adrenergic receptor kinase 1Homo sapiens (human)
alpha-2A adrenergic receptor bindingBeta-adrenergic receptor kinase 1Homo sapiens (human)
Edg-2 lysophosphatidic acid receptor bindingBeta-adrenergic receptor kinase 1Homo sapiens (human)
beta-adrenergic receptor kinase activityBeta-adrenergic receptor kinase 1Homo sapiens (human)
G protein-coupled receptor bindingBeta-adrenergic receptor kinase 1Homo sapiens (human)
RNA bindingProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
RNA helicase activityProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
helicase activityProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
protein bindingProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
ATP bindingProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
ATP hydrolysis activityProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
protein domain specific bindingProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
cadherin bindingProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
mRNA bindingProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
phosphotyrosine residue bindingMitogen-activated protein kinase 3 Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 3 Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase 3 Homo sapiens (human)
protein bindingMitogen-activated protein kinase 3 Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 3 Homo sapiens (human)
phosphatase bindingMitogen-activated protein kinase 3 Homo sapiens (human)
identical protein bindingMitogen-activated protein kinase 3 Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 3 Homo sapiens (human)
DNA-binding transcription factor bindingMitogen-activated protein kinase 3 Homo sapiens (human)
protein serine/threonine kinase activityMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
protein bindingMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
ATP bindingMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
tau protein bindingMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
tau-protein kinase activityMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
protein serine kinase activityMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
deoxyadenosine kinase activityDeoxycytidine kinaseHomo sapiens (human)
deoxycytidine kinase activityDeoxycytidine kinaseHomo sapiens (human)
deoxyguanosine kinase activityDeoxycytidine kinaseHomo sapiens (human)
ATP bindingDeoxycytidine kinaseHomo sapiens (human)
protein homodimerization activityDeoxycytidine kinaseHomo sapiens (human)
cytidine kinase activityDeoxycytidine kinaseHomo sapiens (human)
phosphotyrosine residue bindingMitogen-activated protein kinase 1Homo sapiens (human)
DNA bindingMitogen-activated protein kinase 1Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
protein bindingMitogen-activated protein kinase 1Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 1Homo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
phosphatase bindingMitogen-activated protein kinase 1Homo sapiens (human)
identical protein bindingMitogen-activated protein kinase 1Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
virus receptor activityEphrin type-A receptor 2Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityEphrin type-A receptor 2Homo sapiens (human)
ephrin receptor activityEphrin type-A receptor 2Homo sapiens (human)
protein bindingEphrin type-A receptor 2Homo sapiens (human)
ATP bindingEphrin type-A receptor 2Homo sapiens (human)
growth factor bindingEphrin type-A receptor 2Homo sapiens (human)
cadherin bindingEphrin type-A receptor 2Homo sapiens (human)
molecular function activator activityEphrin type-A receptor 2Homo sapiens (human)
amyloid-beta bindingEphrin type-B receptor 2Homo sapiens (human)
protein tyrosine kinase activityEphrin type-B receptor 2Homo sapiens (human)
transmembrane-ephrin receptor activityEphrin type-B receptor 2Homo sapiens (human)
signaling receptor bindingEphrin type-B receptor 2Homo sapiens (human)
protein bindingEphrin type-B receptor 2Homo sapiens (human)
ATP bindingEphrin type-B receptor 2Homo sapiens (human)
axon guidance receptor activityEphrin type-B receptor 2Homo sapiens (human)
identical protein bindingEphrin type-B receptor 2Homo sapiens (human)
protein-containing complex bindingEphrin type-B receptor 2Homo sapiens (human)
protein tyrosine kinase activityNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
growth hormone receptor bindingNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
protein bindingNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
ATP bindingNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
type 1 angiotensin receptor bindingNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
nucleoside diphosphate kinase activityUMP-CMP kinase Homo sapiens (human)
uridine kinase activityUMP-CMP kinase Homo sapiens (human)
ATP bindingUMP-CMP kinase Homo sapiens (human)
UMP kinase activityUMP-CMP kinase Homo sapiens (human)
CMP kinase activityUMP-CMP kinase Homo sapiens (human)
dCMP kinase activityUMP-CMP kinase Homo sapiens (human)
nucleoside monophosphate kinase activityUMP-CMP kinase Homo sapiens (human)
cytidylate kinase activityUMP-CMP kinase Homo sapiens (human)
RNA bindingPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
serine-type endopeptidase inhibitor activityPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
protein bindingPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
ATP bindingPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
phosphatidylethanolamine bindingPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
enzyme bindingPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
protein kinase bindingPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
magnesium ion bindingWee1-like protein kinaseHomo sapiens (human)
protein tyrosine kinase activityWee1-like protein kinaseHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityWee1-like protein kinaseHomo sapiens (human)
protein bindingWee1-like protein kinaseHomo sapiens (human)
ATP bindingWee1-like protein kinaseHomo sapiens (human)
heme oxygenase (decyclizing) activityHeme oxygenase 2Homo sapiens (human)
protein bindingHeme oxygenase 2Homo sapiens (human)
metal ion bindingHeme oxygenase 2Homo sapiens (human)
heme bindingHeme oxygenase 2Homo sapiens (human)
methionine adenosyltransferase activityS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
protein bindingS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
ATP bindingS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
small molecule bindingS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
identical protein bindingS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
metal ion bindingS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
G protein-coupled receptor bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
ATPase activator activityDnaJ homolog subfamily A member 1Homo sapiens (human)
protein bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
ATP bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
Hsp70 protein bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
Tat protein bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
ubiquitin protein ligase bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
metal ion bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
low-density lipoprotein particle receptor bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
unfolded protein bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
protein-folding chaperone bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
C3HC4-type RING finger domain bindingDnaJ homolog subfamily A member 1Homo sapiens (human)
protein kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
calmodulin bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
ATP bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphatidylinositol-3,4,5-trisphosphate bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
enzyme bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein kinase bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nitric-oxide synthase regulator activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine kinase inhibitor activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
identical protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein homodimerization activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphatidylinositol-3,4-bisphosphate bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
14-3-3 protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
potassium channel activator activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine kinase activityRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
protein bindingRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
ATP bindingRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
metal ion bindingRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
protein serine kinase activityRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
molecular function activator activityRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
monooxygenase activityCytochrome P450 2C19Homo sapiens (human)
iron ion bindingCytochrome P450 2C19Homo sapiens (human)
steroid hydroxylase activityCytochrome P450 2C19Homo sapiens (human)
oxidoreductase activityCytochrome P450 2C19Homo sapiens (human)
(S)-limonene 6-monooxygenase activityCytochrome P450 2C19Homo sapiens (human)
(S)-limonene 7-monooxygenase activityCytochrome P450 2C19Homo sapiens (human)
oxygen bindingCytochrome P450 2C19Homo sapiens (human)
enzyme bindingCytochrome P450 2C19Homo sapiens (human)
heme bindingCytochrome P450 2C19Homo sapiens (human)
(R)-limonene 6-monooxygenase activityCytochrome P450 2C19Homo sapiens (human)
aromatase activityCytochrome P450 2C19Homo sapiens (human)
long-chain fatty acid omega-1 hydroxylase activityCytochrome P450 2C19Homo sapiens (human)
arachidonic acid epoxygenase activityCytochrome P450 2C19Homo sapiens (human)
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenCytochrome P450 2C19Homo sapiens (human)
DNA helicase activityDNA replication licensing factor MCM4Homo sapiens (human)
single-stranded DNA bindingDNA replication licensing factor MCM4Homo sapiens (human)
protein bindingDNA replication licensing factor MCM4Homo sapiens (human)
ATP bindingDNA replication licensing factor MCM4Homo sapiens (human)
ATP hydrolysis activityDNA replication licensing factor MCM4Homo sapiens (human)
single-stranded DNA helicase activityDNA replication licensing factor MCM4Homo sapiens (human)
microfilament motor activityMyosin-10Homo sapiens (human)
actin filament bindingMyosin-10Homo sapiens (human)
microfilament motor activityMyosin-10Homo sapiens (human)
actin bindingMyosin-10Homo sapiens (human)
protein bindingMyosin-10Homo sapiens (human)
calmodulin bindingMyosin-10Homo sapiens (human)
ATP bindingMyosin-10Homo sapiens (human)
RNA stem-loop bindingMyosin-10Homo sapiens (human)
ADP bindingMyosin-10Homo sapiens (human)
mRNA 5'-UTR bindingMyosin-10Homo sapiens (human)
actin filament bindingMyosin-10Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityVascular endothelial growth factor receptor 3Homo sapiens (human)
vascular endothelial growth factor receptor activityVascular endothelial growth factor receptor 3Homo sapiens (human)
protein bindingVascular endothelial growth factor receptor 3Homo sapiens (human)
ATP bindingVascular endothelial growth factor receptor 3Homo sapiens (human)
growth factor bindingVascular endothelial growth factor receptor 3Homo sapiens (human)
protein phosphatase bindingVascular endothelial growth factor receptor 3Homo sapiens (human)
protein homodimerization activityVascular endothelial growth factor receptor 3Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
MAP kinase kinase activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
MAP-kinase scaffold activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
PDZ domain bindingDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
protein serine/threonine kinase activator activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
metal ion bindingDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
scaffold protein bindingDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
protein tyrosine kinase activityReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
cytokine receptor activityReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
vascular endothelial growth factor receptor activityReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
protein bindingReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
ATP bindingReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
nuclear glucocorticoid receptor bindingReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
protein-containing complex bindingReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
phosphatidylinositol 3-kinase activator activityReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
growth factor bindingReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
protein serine/threonine kinase activityBone morphogenetic protein receptor type-1AHomo sapiens (human)
transmembrane receptor protein serine/threonine kinase activityBone morphogenetic protein receptor type-1AHomo sapiens (human)
transforming growth factor beta receptor activity, type IBone morphogenetic protein receptor type-1AHomo sapiens (human)
protein bindingBone morphogenetic protein receptor type-1AHomo sapiens (human)
ATP bindingBone morphogenetic protein receptor type-1AHomo sapiens (human)
BMP bindingBone morphogenetic protein receptor type-1AHomo sapiens (human)
protein homodimerization activityBone morphogenetic protein receptor type-1AHomo sapiens (human)
SMAD bindingBone morphogenetic protein receptor type-1AHomo sapiens (human)
metal ion bindingBone morphogenetic protein receptor type-1AHomo sapiens (human)
BMP receptor activityBone morphogenetic protein receptor type-1AHomo sapiens (human)
activin receptor activityActivin receptor type-1BHomo sapiens (human)
growth factor bindingActivin receptor type-1BHomo sapiens (human)
activin bindingActivin receptor type-1BHomo sapiens (human)
protein serine/threonine kinase activityActivin receptor type-1BHomo sapiens (human)
transmembrane receptor protein serine/threonine kinase activityActivin receptor type-1BHomo sapiens (human)
protein bindingActivin receptor type-1BHomo sapiens (human)
ATP bindingActivin receptor type-1BHomo sapiens (human)
activin receptor activity, type IActivin receptor type-1BHomo sapiens (human)
activin receptor activityActivin receptor type-1BHomo sapiens (human)
ubiquitin protein ligase bindingActivin receptor type-1BHomo sapiens (human)
inhibin bindingActivin receptor type-1BHomo sapiens (human)
SMAD bindingActivin receptor type-1BHomo sapiens (human)
metal ion bindingActivin receptor type-1BHomo sapiens (human)
I-SMAD bindingActivin receptor type-1BHomo sapiens (human)
transforming growth factor beta receptor activityTGF-beta receptor type-1Homo sapiens (human)
growth factor bindingTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta bindingTGF-beta receptor type-1Homo sapiens (human)
protein kinase activityTGF-beta receptor type-1Homo sapiens (human)
protein serine/threonine kinase activityTGF-beta receptor type-1Homo sapiens (human)
transmembrane receptor protein serine/threonine kinase activityTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta receptor activityTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta receptor activity, type ITGF-beta receptor type-1Homo sapiens (human)
type II transforming growth factor beta receptor bindingTGF-beta receptor type-1Homo sapiens (human)
protein bindingTGF-beta receptor type-1Homo sapiens (human)
ATP bindingTGF-beta receptor type-1Homo sapiens (human)
ubiquitin protein ligase bindingTGF-beta receptor type-1Homo sapiens (human)
SMAD bindingTGF-beta receptor type-1Homo sapiens (human)
metal ion bindingTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta bindingTGF-beta receptor type-1Homo sapiens (human)
I-SMAD bindingTGF-beta receptor type-1Homo sapiens (human)
activin receptor activity, type ITGF-beta receptor type-1Homo sapiens (human)
activin bindingTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta bindingTGF-beta receptor type-2Homo sapiens (human)
transmembrane receptor protein serine/threonine kinase activityTGF-beta receptor type-2Homo sapiens (human)
transforming growth factor beta receptor activityTGF-beta receptor type-2Homo sapiens (human)
transforming growth factor beta receptor activity, type IITGF-beta receptor type-2Homo sapiens (human)
protein bindingTGF-beta receptor type-2Homo sapiens (human)
ATP bindingTGF-beta receptor type-2Homo sapiens (human)
glycosaminoglycan bindingTGF-beta receptor type-2Homo sapiens (human)
kinase activator activityTGF-beta receptor type-2Homo sapiens (human)
type I transforming growth factor beta receptor bindingTGF-beta receptor type-2Homo sapiens (human)
SMAD bindingTGF-beta receptor type-2Homo sapiens (human)
metal ion bindingTGF-beta receptor type-2Homo sapiens (human)
transforming growth factor beta bindingTGF-beta receptor type-2Homo sapiens (human)
molecular adaptor activityTGF-beta receptor type-2Homo sapiens (human)
activin receptor activityTGF-beta receptor type-2Homo sapiens (human)
activin bindingTGF-beta receptor type-2Homo sapiens (human)
protein serine/threonine kinase activityTGF-beta receptor type-2Homo sapiens (human)
protein bindingElectron transfer flavoprotein subunit betaHomo sapiens (human)
electron transfer activityElectron transfer flavoprotein subunit betaHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase CSKHomo sapiens (human)
protein bindingTyrosine-protein kinase CSKHomo sapiens (human)
ATP bindingTyrosine-protein kinase CSKHomo sapiens (human)
protein phosphatase bindingTyrosine-protein kinase CSKHomo sapiens (human)
protein kinase A catalytic subunit bindingTyrosine-protein kinase CSKHomo sapiens (human)
identical protein bindingTyrosine-protein kinase CSKHomo sapiens (human)
metal ion bindingTyrosine-protein kinase CSKHomo sapiens (human)
proline-rich region bindingTyrosine-protein kinase CSKHomo sapiens (human)
protein tyrosine kinase bindingTyrosine-protein kinase CSKHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase CSKHomo sapiens (human)
bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activityGlycine--tRNA ligaseHomo sapiens (human)
glycine-tRNA ligase activityGlycine--tRNA ligaseHomo sapiens (human)
protein bindingGlycine--tRNA ligaseHomo sapiens (human)
ATP bindingGlycine--tRNA ligaseHomo sapiens (human)
transferase activityGlycine--tRNA ligaseHomo sapiens (human)
identical protein bindingGlycine--tRNA ligaseHomo sapiens (human)
protein dimerization activityGlycine--tRNA ligaseHomo sapiens (human)
protein kinase activityProtein kinase C iota typeHomo sapiens (human)
protein serine/threonine kinase activityProtein kinase C iota typeHomo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activityProtein kinase C iota typeHomo sapiens (human)
protein bindingProtein kinase C iota typeHomo sapiens (human)
ATP bindingProtein kinase C iota typeHomo sapiens (human)
phospholipid bindingProtein kinase C iota typeHomo sapiens (human)
metal ion bindingProtein kinase C iota typeHomo sapiens (human)
protein serine kinase activityProtein kinase C iota typeHomo sapiens (human)
RNA bindingExosome RNA helicase MTR4Homo sapiens (human)
RNA helicase activityExosome RNA helicase MTR4Homo sapiens (human)
protein bindingExosome RNA helicase MTR4Homo sapiens (human)
ATP bindingExosome RNA helicase MTR4Homo sapiens (human)
ATP hydrolysis activityExosome RNA helicase MTR4Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase TecHomo sapiens (human)
protein bindingTyrosine-protein kinase TecHomo sapiens (human)
ATP bindingTyrosine-protein kinase TecHomo sapiens (human)
phospholipid bindingTyrosine-protein kinase TecHomo sapiens (human)
metal ion bindingTyrosine-protein kinase TecHomo sapiens (human)
magnesium ion bindingTyrosine-protein kinase ABL2Homo sapiens (human)
phosphotyrosine residue bindingTyrosine-protein kinase ABL2Homo sapiens (human)
actin monomer bindingTyrosine-protein kinase ABL2Homo sapiens (human)
protein kinase activityTyrosine-protein kinase ABL2Homo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase ABL2Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase ABL2Homo sapiens (human)
protein bindingTyrosine-protein kinase ABL2Homo sapiens (human)
ATP bindingTyrosine-protein kinase ABL2Homo sapiens (human)
manganese ion bindingTyrosine-protein kinase ABL2Homo sapiens (human)
actin filament bindingTyrosine-protein kinase ABL2Homo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase FRKHomo sapiens (human)
protein bindingTyrosine-protein kinase FRKHomo sapiens (human)
ATP bindingTyrosine-protein kinase FRKHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase FRKHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase FRKHomo sapiens (human)
phosphotyrosine residue bindingTyrosine-protein kinase SYKHomo sapiens (human)
protein kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
protein serine/threonine kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase SYKHomo sapiens (human)
integrin bindingTyrosine-protein kinase SYKHomo sapiens (human)
protein bindingTyrosine-protein kinase SYKHomo sapiens (human)
ATP bindingTyrosine-protein kinase SYKHomo sapiens (human)
interleukin-15 receptor bindingTyrosine-protein kinase SYKHomo sapiens (human)
kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
protein kinase bindingTyrosine-protein kinase SYKHomo sapiens (human)
phosphatase bindingTyrosine-protein kinase SYKHomo sapiens (human)
Toll-like receptor bindingTyrosine-protein kinase SYKHomo sapiens (human)
SH2 domain bindingTyrosine-protein kinase SYKHomo sapiens (human)
phospholipase bindingTyrosine-protein kinase SYKHomo sapiens (human)
scaffold protein bindingTyrosine-protein kinase SYKHomo sapiens (human)
protein binding26S proteasome regulatory subunit 6BHomo sapiens (human)
ATP binding26S proteasome regulatory subunit 6BHomo sapiens (human)
ATP hydrolysis activity26S proteasome regulatory subunit 6BHomo sapiens (human)
proteasome-activating activity26S proteasome regulatory subunit 6BHomo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 8Homo sapiens (human)
JUN kinase activityMitogen-activated protein kinase 8Homo sapiens (human)
protein bindingMitogen-activated protein kinase 8Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 8Homo sapiens (human)
enzyme bindingMitogen-activated protein kinase 8Homo sapiens (human)
protein phosphatase bindingMitogen-activated protein kinase 8Homo sapiens (human)
histone deacetylase regulator activityMitogen-activated protein kinase 8Homo sapiens (human)
histone deacetylase bindingMitogen-activated protein kinase 8Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 8Homo sapiens (human)
protein serine/threonine kinase bindingMitogen-activated protein kinase 8Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 9Homo sapiens (human)
JUN kinase activityMitogen-activated protein kinase 9Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityMitogen-activated protein kinase 9Homo sapiens (human)
protein bindingMitogen-activated protein kinase 9Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 9Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 9Homo sapiens (human)
protein kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
JUN kinase kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
molecular adaptor activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
MAP kinase kinase activityDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
protein kinase bindingDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
protein bindingPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
ATP bindingPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
1-phosphatidylinositol-4-phosphate 5-kinase activityPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
1-phosphatidylinositol-5-phosphate 4-kinase activityPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
protein homodimerization activityPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
protein kinase activityCasein kinase I isoform alphaHomo sapiens (human)
protein serine/threonine kinase activityCasein kinase I isoform alphaHomo sapiens (human)
protein bindingCasein kinase I isoform alphaHomo sapiens (human)
ATP bindingCasein kinase I isoform alphaHomo sapiens (human)
protein serine kinase activityCasein kinase I isoform alphaHomo sapiens (human)
protein kinase activityCasein kinase I isoform deltaHomo sapiens (human)
protein serine/threonine kinase activityCasein kinase I isoform deltaHomo sapiens (human)
protein bindingCasein kinase I isoform deltaHomo sapiens (human)
ATP bindingCasein kinase I isoform deltaHomo sapiens (human)
cadherin bindingCasein kinase I isoform deltaHomo sapiens (human)
tau-protein kinase activityCasein kinase I isoform deltaHomo sapiens (human)
protein serine kinase activityCasein kinase I isoform deltaHomo sapiens (human)
protein kinase activityMAP kinase-activated protein kinase 2Homo sapiens (human)
protein serine/threonine kinase activityMAP kinase-activated protein kinase 2Homo sapiens (human)
protein bindingMAP kinase-activated protein kinase 2Homo sapiens (human)
ATP bindingMAP kinase-activated protein kinase 2Homo sapiens (human)
protein serine kinase activityMAP kinase-activated protein kinase 2Homo sapiens (human)
calcium-dependent protein serine/threonine kinase activityMAP kinase-activated protein kinase 2Homo sapiens (human)
calmodulin bindingMAP kinase-activated protein kinase 2Homo sapiens (human)
calmodulin-dependent protein kinase activityMAP kinase-activated protein kinase 2Homo sapiens (human)
mitogen-activated protein kinase bindingMAP kinase-activated protein kinase 2Homo sapiens (human)
RNA bindingElongation factor Tu, mitochondrialHomo sapiens (human)
translation elongation factor activityElongation factor Tu, mitochondrialHomo sapiens (human)
GTPase activityElongation factor Tu, mitochondrialHomo sapiens (human)
protein bindingElongation factor Tu, mitochondrialHomo sapiens (human)
GTP bindingElongation factor Tu, mitochondrialHomo sapiens (human)
choline-phosphate cytidylyltransferase activityCholine-phosphate cytidylyltransferase AHomo sapiens (human)
protein bindingCholine-phosphate cytidylyltransferase AHomo sapiens (human)
calmodulin bindingCholine-phosphate cytidylyltransferase AHomo sapiens (human)
identical protein bindingCholine-phosphate cytidylyltransferase AHomo sapiens (human)
protein homodimerization activityCholine-phosphate cytidylyltransferase AHomo sapiens (human)
molecular function inhibitor activityCholine-phosphate cytidylyltransferase AHomo sapiens (human)
phosphatidylcholine bindingCholine-phosphate cytidylyltransferase AHomo sapiens (human)
RNA bindingCasein kinase I isoform epsilonHomo sapiens (human)
protein kinase activityCasein kinase I isoform epsilonHomo sapiens (human)
protein serine/threonine kinase activityCasein kinase I isoform epsilonHomo sapiens (human)
protein bindingCasein kinase I isoform epsilonHomo sapiens (human)
ATP bindingCasein kinase I isoform epsilonHomo sapiens (human)
protein serine kinase activityCasein kinase I isoform epsilonHomo sapiens (human)
acyl-CoA dehydrogenase activityVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
long-chain fatty acyl-CoA dehydrogenase activityVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
protein bindingVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
very-long-chain fatty acyl-CoA dehydrogenase activityVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
identical protein bindingVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
flavin adenine dinucleotide bindingVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
fatty-acyl-CoA bindingVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
protein serine/threonine kinase activityDual specificity protein kinase CLK2Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityDual specificity protein kinase CLK2Homo sapiens (human)
protein bindingDual specificity protein kinase CLK2Homo sapiens (human)
ATP bindingDual specificity protein kinase CLK2Homo sapiens (human)
identical protein bindingDual specificity protein kinase CLK2Homo sapiens (human)
protein serine kinase activityDual specificity protein kinase CLK2Homo sapiens (human)
protein tyrosine kinase activityDual specificity protein kinase CLK2Homo sapiens (human)
protein serine/threonine kinase activityGlycogen synthase kinase-3 alphaHomo sapiens (human)
signaling receptor bindingGlycogen synthase kinase-3 alphaHomo sapiens (human)
protein bindingGlycogen synthase kinase-3 alphaHomo sapiens (human)
ATP bindingGlycogen synthase kinase-3 alphaHomo sapiens (human)
protein kinase A catalytic subunit bindingGlycogen synthase kinase-3 alphaHomo sapiens (human)
tau protein bindingGlycogen synthase kinase-3 alphaHomo sapiens (human)
tau-protein kinase activityGlycogen synthase kinase-3 alphaHomo sapiens (human)
protein serine kinase activityGlycogen synthase kinase-3 alphaHomo sapiens (human)
protease bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
p53 bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein serine/threonine kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
ATP bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
beta-catenin bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
ubiquitin protein ligase bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase A catalytic subunit bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
dynactin bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
tau protein bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
tau-protein kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
NF-kappaB bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
RNA polymerase II-specific DNA-binding transcription factor bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
protein serine kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase activityCyclin-dependent kinase 7Homo sapiens (human)
protein serine/threonine kinase activityCyclin-dependent kinase 7Homo sapiens (human)
protein bindingCyclin-dependent kinase 7Homo sapiens (human)
ATP bindingCyclin-dependent kinase 7Homo sapiens (human)
ATP-dependent activity, acting on DNACyclin-dependent kinase 7Homo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityCyclin-dependent kinase 7Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 7Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 7Homo sapiens (human)
RNA polymerase II cis-regulatory region sequence-specific DNA bindingCyclin-dependent kinase 9Homo sapiens (human)
transcription coactivator bindingCyclin-dependent kinase 9Homo sapiens (human)
DNA bindingCyclin-dependent kinase 9Homo sapiens (human)
chromatin bindingCyclin-dependent kinase 9Homo sapiens (human)
transcription elongation factor activityCyclin-dependent kinase 9Homo sapiens (human)
protein kinase activityCyclin-dependent kinase 9Homo sapiens (human)
protein serine/threonine kinase activityCyclin-dependent kinase 9Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 9Homo sapiens (human)
protein bindingCyclin-dependent kinase 9Homo sapiens (human)
ATP bindingCyclin-dependent kinase 9Homo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityCyclin-dependent kinase 9Homo sapiens (human)
kinase activityCyclin-dependent kinase 9Homo sapiens (human)
protein kinase bindingCyclin-dependent kinase 9Homo sapiens (human)
7SK snRNA bindingCyclin-dependent kinase 9Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 9Homo sapiens (human)
GTPase activityRas-related protein Rab-27AHomo sapiens (human)
G protein activityRas-related protein Rab-27AHomo sapiens (human)
protein bindingRas-related protein Rab-27AHomo sapiens (human)
GTP bindingRas-related protein Rab-27AHomo sapiens (human)
GDP bindingRas-related protein Rab-27AHomo sapiens (human)
protein domain specific bindingRas-related protein Rab-27AHomo sapiens (human)
myosin V bindingRas-related protein Rab-27AHomo sapiens (human)
protein kinase activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein serine/threonine kinase activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein bindingInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
ATP bindingInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
kinase activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein kinase bindingInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
heat shock protein bindingInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
identical protein bindingInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein homodimerization activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein heterodimerization activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein serine kinase activityInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
magnesium ion bindingRibosomal protein S6 kinase alpha-3Homo sapiens (human)
protein kinase activityRibosomal protein S6 kinase alpha-3Homo sapiens (human)
protein serine/threonine kinase activityRibosomal protein S6 kinase alpha-3Homo sapiens (human)
protein bindingRibosomal protein S6 kinase alpha-3Homo sapiens (human)
ATP bindingRibosomal protein S6 kinase alpha-3Homo sapiens (human)
protein kinase bindingRibosomal protein S6 kinase alpha-3Homo sapiens (human)
cysteine-type endopeptidase inhibitor activity involved in apoptotic processRibosomal protein S6 kinase alpha-3Homo sapiens (human)
protein serine kinase activityRibosomal protein S6 kinase alpha-3Homo sapiens (human)
ribosomal protein S6 kinase activityRibosomal protein S6 kinase alpha-3Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase Nek2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase Nek2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase Nek2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase Nek2Homo sapiens (human)
protein phosphatase bindingSerine/threonine-protein kinase Nek2Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase Nek2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase Nek2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase Nek3Homo sapiens (human)
protein bindingSerine/threonine-protein kinase Nek3Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase Nek3Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase Nek3Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase Nek3Homo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase JAK3Homo sapiens (human)
protein bindingTyrosine-protein kinase JAK3Homo sapiens (human)
ATP bindingTyrosine-protein kinase JAK3Homo sapiens (human)
protein phosphatase bindingTyrosine-protein kinase JAK3Homo sapiens (human)
growth hormone receptor bindingTyrosine-protein kinase JAK3Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase JAK3Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
MAP kinase kinase activityDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
protein kinase bindingDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase PLK1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase PLK1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
microtubule bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
anaphase-promoting complex bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein kinase bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase PLK1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase PLK1Homo sapiens (human)
protein kinase activityLIM domain kinase 1Homo sapiens (human)
protein serine/threonine kinase activityLIM domain kinase 1Homo sapiens (human)
protein bindingLIM domain kinase 1Homo sapiens (human)
ATP bindingLIM domain kinase 1Homo sapiens (human)
heat shock protein bindingLIM domain kinase 1Homo sapiens (human)
metal ion bindingLIM domain kinase 1Homo sapiens (human)
protein serine kinase activityLIM domain kinase 1Homo sapiens (human)
protein serine/threonine kinase activityLIM domain kinase 2Homo sapiens (human)
protein bindingLIM domain kinase 2Homo sapiens (human)
ATP bindingLIM domain kinase 2Homo sapiens (human)
metal ion bindingLIM domain kinase 2Homo sapiens (human)
protein serine kinase activityLIM domain kinase 2Homo sapiens (human)
JUN kinase activityMitogen-activated protein kinase 10Homo sapiens (human)
MAP kinase kinase activityMitogen-activated protein kinase 10Homo sapiens (human)
protein bindingMitogen-activated protein kinase 10Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 10Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 10Homo sapiens (human)
tRNA bindingTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
RNA bindingTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
tyrosine-tRNA ligase activityTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
interleukin-8 receptor bindingTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
protein bindingTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
ATP bindingTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
small molecule bindingTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
protein kinase activity5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
cAMP-dependent protein kinase activity5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
protein binding5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
ATP binding5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
cAMP-dependent protein kinase regulator activity5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
AMP binding5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
protein kinase regulator activity5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
protein kinase binding5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
ADP binding5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
ephrin receptor activityEphrin type-B receptor 3Homo sapiens (human)
protein bindingEphrin type-B receptor 3Homo sapiens (human)
ATP bindingEphrin type-B receptor 3Homo sapiens (human)
axon guidance receptor activityEphrin type-B receptor 3Homo sapiens (human)
transmembrane-ephrin receptor activityEphrin type-B receptor 3Homo sapiens (human)
ephrin receptor activityEphrin type-A receptor 5Homo sapiens (human)
GPI-linked ephrin receptor activityEphrin type-A receptor 5Homo sapiens (human)
transmembrane-ephrin receptor activityEphrin type-A receptor 5Homo sapiens (human)
protein bindingEphrin type-A receptor 5Homo sapiens (human)
ATP bindingEphrin type-A receptor 5Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityEphrin type-B receptor 4Homo sapiens (human)
ephrin receptor activityEphrin type-B receptor 4Homo sapiens (human)
protein bindingEphrin type-B receptor 4Homo sapiens (human)
ATP bindingEphrin type-B receptor 4Homo sapiens (human)
amyloid-beta bindingEphrin type-A receptor 4Homo sapiens (human)
protein kinase activityEphrin type-A receptor 4Homo sapiens (human)
protein tyrosine kinase activityEphrin type-A receptor 4Homo sapiens (human)
GPI-linked ephrin receptor activityEphrin type-A receptor 4Homo sapiens (human)
transmembrane-ephrin receptor activityEphrin type-A receptor 4Homo sapiens (human)
protein bindingEphrin type-A receptor 4Homo sapiens (human)
ATP bindingEphrin type-A receptor 4Homo sapiens (human)
kinase activityEphrin type-A receptor 4Homo sapiens (human)
PH domain bindingEphrin type-A receptor 4Homo sapiens (human)
identical protein bindingEphrin type-A receptor 4Homo sapiens (human)
ephrin receptor bindingEphrin type-A receptor 4Homo sapiens (human)
DH domain bindingEphrin type-A receptor 4Homo sapiens (human)
protein tyrosine kinase bindingEphrin type-A receptor 4Homo sapiens (human)
adenylate kinase activityAdenylate kinase 2, mitochondrialHomo sapiens (human)
protein bindingAdenylate kinase 2, mitochondrialHomo sapiens (human)
ATP bindingAdenylate kinase 2, mitochondrialHomo sapiens (human)
RNA bindingAdenosine kinaseHomo sapiens (human)
deoxyadenosine kinase activityAdenosine kinaseHomo sapiens (human)
ATP bindingAdenosine kinaseHomo sapiens (human)
metal ion bindingAdenosine kinaseHomo sapiens (human)
adenosine kinase activityAdenosine kinaseHomo sapiens (human)
G protein activityRas-related protein Rab-10Homo sapiens (human)
protein bindingRas-related protein Rab-10Homo sapiens (human)
GTP bindingRas-related protein Rab-10Homo sapiens (human)
GDP bindingRas-related protein Rab-10Homo sapiens (human)
myosin V bindingRas-related protein Rab-10Homo sapiens (human)
cadherin binding involved in cell-cell adhesionRas-related protein Rab-10Homo sapiens (human)
actin filament bindingActin-related protein 3Homo sapiens (human)
structural constituent of cytoskeletonActin-related protein 3Homo sapiens (human)
protein bindingActin-related protein 3Homo sapiens (human)
ATP bindingActin-related protein 3Homo sapiens (human)
actin filament bindingActin-related protein 2Homo sapiens (human)
structural constituent of cytoskeletonActin-related protein 2Homo sapiens (human)
protein bindingActin-related protein 2Homo sapiens (human)
ATP bindingActin-related protein 2Homo sapiens (human)
nuclear export signal receptor activityGTP-binding nuclear protein RanHomo sapiens (human)
pre-miRNA bindingGTP-binding nuclear protein RanHomo sapiens (human)
magnesium ion bindingGTP-binding nuclear protein RanHomo sapiens (human)
chromatin bindingGTP-binding nuclear protein RanHomo sapiens (human)
RNA bindingGTP-binding nuclear protein RanHomo sapiens (human)
GTPase activityGTP-binding nuclear protein RanHomo sapiens (human)
G protein activityGTP-binding nuclear protein RanHomo sapiens (human)
protein bindingGTP-binding nuclear protein RanHomo sapiens (human)
GTP bindingGTP-binding nuclear protein RanHomo sapiens (human)
GDP bindingGTP-binding nuclear protein RanHomo sapiens (human)
protein domain specific bindingGTP-binding nuclear protein RanHomo sapiens (human)
cadherin bindingGTP-binding nuclear protein RanHomo sapiens (human)
dynein intermediate chain bindingGTP-binding nuclear protein RanHomo sapiens (human)
protein heterodimerization activityGTP-binding nuclear protein RanHomo sapiens (human)
importin-alpha family protein bindingGTP-binding nuclear protein RanHomo sapiens (human)
GTPase activityRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
G protein activityRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
protein bindingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
GTP bindingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
enzyme bindingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
protein kinase bindingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
thioesterase bindingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
protein-containing complex bindingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
Rho GDP-dissociation inhibitor bindingRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
protein serine/threonine kinase activityCasein kinase I isoform gamma-2Homo sapiens (human)
protein bindingCasein kinase I isoform gamma-2Homo sapiens (human)
ATP bindingCasein kinase I isoform gamma-2Homo sapiens (human)
protein serine kinase activityCasein kinase I isoform gamma-2Homo sapiens (human)
protein bindingCyclin-dependent kinase 3Homo sapiens (human)
ATP bindingCyclin-dependent kinase 3Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 3Homo sapiens (human)
cyclin bindingCyclin-dependent kinase 3Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 3Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 6Homo sapiens (human)
protein bindingCyclin-dependent kinase 6Homo sapiens (human)
ATP bindingCyclin-dependent kinase 6Homo sapiens (human)
cyclin bindingCyclin-dependent kinase 6Homo sapiens (human)
FBXO family protein bindingCyclin-dependent kinase 6Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 6Homo sapiens (human)
microtubule bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
p53 bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
protein kinase activityCyclin-dependent-like kinase 5 Homo sapiens (human)
protein serine/threonine kinase activityCyclin-dependent-like kinase 5 Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent-like kinase 5 Homo sapiens (human)
ErbB-2 class receptor bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
protein bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
ATP bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
kinase activityCyclin-dependent-like kinase 5 Homo sapiens (human)
acetylcholine receptor activator activityCyclin-dependent-like kinase 5 Homo sapiens (human)
ErbB-3 class receptor bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
tau protein bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
tau-protein kinase activityCyclin-dependent-like kinase 5 Homo sapiens (human)
Hsp90 protein bindingCyclin-dependent-like kinase 5 Homo sapiens (human)
protein serine kinase activityCyclin-dependent-like kinase 5 Homo sapiens (human)
protein serine/threonine kinase activityCyclin-dependent kinase 16Homo sapiens (human)
protein bindingCyclin-dependent kinase 16Homo sapiens (human)
ATP bindingCyclin-dependent kinase 16Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 16Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 16Homo sapiens (human)
protein kinase activityCyclin-dependent kinase 17Homo sapiens (human)
protein bindingCyclin-dependent kinase 17Homo sapiens (human)
ATP bindingCyclin-dependent kinase 17Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 17Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 17Homo sapiens (human)
6-phosphofructokinase activityATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
protein bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
protein-containing complex bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
cadherin bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
metal ion bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
ATP bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
monosaccharide bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
AMP bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
identical protein bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
fructose-6-phosphate bindingATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
protein kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
MAP kinase kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
MAP-kinase scaffold activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein kinase activator activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine/threonine kinase activator activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
scaffold protein bindingDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
DNA bindingDNA topoisomerase 2-betaHomo sapiens (human)
chromatin bindingDNA topoisomerase 2-betaHomo sapiens (human)
DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activityDNA topoisomerase 2-betaHomo sapiens (human)
protein bindingDNA topoisomerase 2-betaHomo sapiens (human)
ATP bindingDNA topoisomerase 2-betaHomo sapiens (human)
ribonucleoprotein complex bindingDNA topoisomerase 2-betaHomo sapiens (human)
metal ion bindingDNA topoisomerase 2-betaHomo sapiens (human)
protein kinase activityProtein kinase C theta typeHomo sapiens (human)
protein serine/threonine kinase activityProtein kinase C theta typeHomo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activityProtein kinase C theta typeHomo sapiens (human)
protein bindingProtein kinase C theta typeHomo sapiens (human)
ATP bindingProtein kinase C theta typeHomo sapiens (human)
metal ion bindingProtein kinase C theta typeHomo sapiens (human)
protein serine kinase activityProtein kinase C theta typeHomo sapiens (human)
activin receptor activity, type IActivin receptor type-1Homo sapiens (human)
protein kinase activityActivin receptor type-1Homo sapiens (human)
protein serine/threonine kinase activityActivin receptor type-1Homo sapiens (human)
transmembrane receptor protein serine/threonine kinase activityActivin receptor type-1Homo sapiens (human)
protein bindingActivin receptor type-1Homo sapiens (human)
ATP bindingActivin receptor type-1Homo sapiens (human)
peptide hormone bindingActivin receptor type-1Homo sapiens (human)
protein homodimerization activityActivin receptor type-1Homo sapiens (human)
cadherin bindingActivin receptor type-1Homo sapiens (human)
SMAD bindingActivin receptor type-1Homo sapiens (human)
metal ion bindingActivin receptor type-1Homo sapiens (human)
activin bindingActivin receptor type-1Homo sapiens (human)
transforming growth factor beta bindingActivin receptor type-1Homo sapiens (human)
BMP receptor activityActivin receptor type-1Homo sapiens (human)
protein tyrosine kinase bindingActivin receptor type-1Homo sapiens (human)
transforming growth factor beta receptor activity, type IActivin receptor type-1Homo sapiens (human)
macrophage colony-stimulating factor receptor activityMacrophage-stimulating protein receptorHomo sapiens (human)
protein bindingMacrophage-stimulating protein receptorHomo sapiens (human)
ATP bindingMacrophage-stimulating protein receptorHomo sapiens (human)
enzyme bindingMacrophage-stimulating protein receptorHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activityMacrophage-stimulating protein receptorHomo sapiens (human)
actin bindingFocal adhesion kinase 1Homo sapiens (human)
protein tyrosine kinase activityFocal adhesion kinase 1Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityFocal adhesion kinase 1Homo sapiens (human)
protein tyrosine phosphatase activityFocal adhesion kinase 1Homo sapiens (human)
integrin bindingFocal adhesion kinase 1Homo sapiens (human)
protein bindingFocal adhesion kinase 1Homo sapiens (human)
ATP bindingFocal adhesion kinase 1Homo sapiens (human)
JUN kinase bindingFocal adhesion kinase 1Homo sapiens (human)
protein kinase bindingFocal adhesion kinase 1Homo sapiens (human)
protein phosphatase bindingFocal adhesion kinase 1Homo sapiens (human)
SH2 domain bindingFocal adhesion kinase 1Homo sapiens (human)
molecular function activator activityFocal adhesion kinase 1Homo sapiens (human)
protein kinase activityProtein kinase C delta typeHomo sapiens (human)
protein serine/threonine kinase activityProtein kinase C delta typeHomo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activityProtein kinase C delta typeHomo sapiens (human)
diacylglycerol-dependent, calcium-independent serine/threonine kinase activityProtein kinase C delta typeHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityProtein kinase C delta typeHomo sapiens (human)
protein bindingProtein kinase C delta typeHomo sapiens (human)
ATP bindingProtein kinase C delta typeHomo sapiens (human)
enzyme activator activityProtein kinase C delta typeHomo sapiens (human)
enzyme bindingProtein kinase C delta typeHomo sapiens (human)
protein kinase bindingProtein kinase C delta typeHomo sapiens (human)
insulin receptor substrate bindingProtein kinase C delta typeHomo sapiens (human)
metal ion bindingProtein kinase C delta typeHomo sapiens (human)
protein serine kinase activityProtein kinase C delta typeHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase BTKHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase BTKHomo sapiens (human)
protein bindingTyrosine-protein kinase BTKHomo sapiens (human)
ATP bindingTyrosine-protein kinase BTKHomo sapiens (human)
phosphatidylinositol-3,4,5-trisphosphate bindingTyrosine-protein kinase BTKHomo sapiens (human)
phospholipase activator activityTyrosine-protein kinase BTKHomo sapiens (human)
identical protein bindingTyrosine-protein kinase BTKHomo sapiens (human)
phospholipase bindingTyrosine-protein kinase BTKHomo sapiens (human)
metal ion bindingTyrosine-protein kinase BTKHomo sapiens (human)
protein serine/threonine kinase activityActivated CDC42 kinase 1Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityActivated CDC42 kinase 1Homo sapiens (human)
protein tyrosine kinase activityActivated CDC42 kinase 1Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityActivated CDC42 kinase 1Homo sapiens (human)
GTPase inhibitor activityActivated CDC42 kinase 1Homo sapiens (human)
epidermal growth factor receptor bindingActivated CDC42 kinase 1Homo sapiens (human)
protein bindingActivated CDC42 kinase 1Homo sapiens (human)
ATP bindingActivated CDC42 kinase 1Homo sapiens (human)
ubiquitin protein ligase bindingActivated CDC42 kinase 1Homo sapiens (human)
identical protein bindingActivated CDC42 kinase 1Homo sapiens (human)
metal ion bindingActivated CDC42 kinase 1Homo sapiens (human)
WW domain bindingActivated CDC42 kinase 1Homo sapiens (human)
protein serine kinase activityActivated CDC42 kinase 1Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
protein bindingEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
collagen bindingEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
ATP bindingEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
protein tyrosine kinase collagen receptor activityEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
metal ion bindingEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
transcription cis-regulatory region bindingPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
inward rectifier potassium channel activityPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
voltage-gated potassium channel activityPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
delayed rectifier potassium channel activityPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
protein bindingPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
ubiquitin protein ligase bindingPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
identical protein bindingPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
protein homodimerization activityPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
C3HC4-type RING finger domain bindingPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarizationPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
scaffold protein bindingPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarizationPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
mitogen-activated protein kinase kinase kinase bindingMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
MAP kinase kinase kinase kinase activityMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase 4Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase 4Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase 4Homo sapiens (human)
protein bindingSerine/threonine-protein kinase 4Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase 4Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase 4Homo sapiens (human)
protein homodimerization activitySerine/threonine-protein kinase 4Homo sapiens (human)
protein serine/threonine kinase activator activitySerine/threonine-protein kinase 4Homo sapiens (human)
RNA polymerase II-specific DNA-binding transcription factor bindingSerine/threonine-protein kinase 4Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase 4Homo sapiens (human)
chromatin binding5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
protein kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
protein serine/threonine kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
AMP-activated protein kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cAMP-dependent protein kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
protein binding5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
ATP binding5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
metal ion binding5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
[hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
tau protein binding5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
tau-protein kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
protein serine kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
histone H2BS36 kinase activity5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
protein kinase activityDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
metal ion bindingDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
MAP kinase kinase activityDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase 7Homo sapiens (human)
enzyme inhibitor activityMitogen-activated protein kinase 7Homo sapiens (human)
protein bindingMitogen-activated protein kinase 7Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 7Homo sapiens (human)
mitogen-activated protein kinase bindingMitogen-activated protein kinase 7Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 7Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 7Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase PAK 2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein kinase bindingSerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein tyrosine kinase activator activitySerine/threonine-protein kinase PAK 2Homo sapiens (human)
small GTPase bindingSerine/threonine-protein kinase PAK 2Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase PAK 2Homo sapiens (human)
cadherin bindingSerine/threonine-protein kinase PAK 2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase PAK 2Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase 3Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase 3Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase 3Homo sapiens (human)
protein bindingSerine/threonine-protein kinase 3Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase 3Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase 3Homo sapiens (human)
protein serine/threonine kinase activator activitySerine/threonine-protein kinase 3Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase 3Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
zinc ion bindingMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
protein kinase bindingMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
protein serine/threonine kinase activityIntegrin-linked protein kinaseHomo sapiens (human)
protein bindingIntegrin-linked protein kinaseHomo sapiens (human)
ATP bindingIntegrin-linked protein kinaseHomo sapiens (human)
protein kinase bindingIntegrin-linked protein kinaseHomo sapiens (human)
protein serine kinase activityIntegrin-linked protein kinaseHomo sapiens (human)
protein kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein serine/threonine kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein bindingRho-associated protein kinase 1Homo sapiens (human)
ATP bindingRho-associated protein kinase 1Homo sapiens (human)
small GTPase bindingRho-associated protein kinase 1Homo sapiens (human)
metal ion bindingRho-associated protein kinase 1Homo sapiens (human)
tau protein bindingRho-associated protein kinase 1Homo sapiens (human)
tau-protein kinase activityRho-associated protein kinase 1Homo sapiens (human)
Rho-dependent protein serine/threonine kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein serine kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein tyrosine kinase activityNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
protein bindingNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
ATP bindingNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
DNA bindingSerine/threonine-protein kinase ATRHomo sapiens (human)
protein kinase activitySerine/threonine-protein kinase ATRHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase ATRHomo sapiens (human)
protein bindingSerine/threonine-protein kinase ATRHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase ATRHomo sapiens (human)
MutLalpha complex bindingSerine/threonine-protein kinase ATRHomo sapiens (human)
MutSalpha complex bindingSerine/threonine-protein kinase ATRHomo sapiens (human)
histone H2AXS139 kinase activitySerine/threonine-protein kinase ATRHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase ATRHomo sapiens (human)
calcium-dependent protein serine/threonine phosphatase activityCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
protein bindingCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
calmodulin bindingCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
ATP bindingCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
identical protein bindingCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
protein homodimerization activityCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
protein serine kinase activityCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
calmodulin-dependent protein kinase activityCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
protein serine/threonine kinase activityCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
calmodulin-dependent protein kinase activityCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
protein bindingCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
calmodulin bindingCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
ATP bindingCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
sodium channel inhibitor activityCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
titin bindingCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
identical protein bindingCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
protein homodimerization activityCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
transmembrane transporter bindingCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
protein serine kinase activityCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
protein kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
protein serine/threonine kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
protein tyrosine kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
protein bindingDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
ATP bindingDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
identical protein bindingDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
tau protein bindingDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
tau-protein kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
protein serine kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
histone H3T45 kinase activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
transcription coactivator activityDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
activin receptor activity, type IIActivin receptor type-2BHomo sapiens (human)
protein serine/threonine kinase activityActivin receptor type-2BHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityActivin receptor type-2BHomo sapiens (human)
protein bindingActivin receptor type-2BHomo sapiens (human)
ATP bindingActivin receptor type-2BHomo sapiens (human)
activin receptor activity, type IIActivin receptor type-2BHomo sapiens (human)
kinase activator activityActivin receptor type-2BHomo sapiens (human)
growth factor bindingActivin receptor type-2BHomo sapiens (human)
metal ion bindingActivin receptor type-2BHomo sapiens (human)
activin bindingActivin receptor type-2BHomo sapiens (human)
activin receptor activityActivin receptor type-2BHomo sapiens (human)
protein bindingBone morphogenetic protein receptor type-2Homo sapiens (human)
ATP bindingBone morphogenetic protein receptor type-2Homo sapiens (human)
activin receptor activity, type IIBone morphogenetic protein receptor type-2Homo sapiens (human)
growth factor bindingBone morphogenetic protein receptor type-2Homo sapiens (human)
BMP bindingBone morphogenetic protein receptor type-2Homo sapiens (human)
cadherin bindingBone morphogenetic protein receptor type-2Homo sapiens (human)
metal ion bindingBone morphogenetic protein receptor type-2Homo sapiens (human)
BMP receptor activityBone morphogenetic protein receptor type-2Homo sapiens (human)
protein tyrosine kinase bindingBone morphogenetic protein receptor type-2Homo sapiens (human)
transforming growth factor beta receptor activityBone morphogenetic protein receptor type-2Homo sapiens (human)
protein tyrosine kinase activityProtein-tyrosine kinase 6Homo sapiens (human)
non-membrane spanning protein tyrosine kinase activityProtein-tyrosine kinase 6Homo sapiens (human)
protein bindingProtein-tyrosine kinase 6Homo sapiens (human)
ATP bindingProtein-tyrosine kinase 6Homo sapiens (human)
identical protein bindingProtein-tyrosine kinase 6Homo sapiens (human)
signaling receptor bindingProtein-tyrosine kinase 6Homo sapiens (human)
protein kinase activitycGMP-dependent protein kinase 1 Homo sapiens (human)
cGMP-dependent protein kinase activitycGMP-dependent protein kinase 1 Homo sapiens (human)
calcium channel regulator activitycGMP-dependent protein kinase 1 Homo sapiens (human)
protein bindingcGMP-dependent protein kinase 1 Homo sapiens (human)
ATP bindingcGMP-dependent protein kinase 1 Homo sapiens (human)
cGMP bindingcGMP-dependent protein kinase 1 Homo sapiens (human)
identical protein bindingcGMP-dependent protein kinase 1 Homo sapiens (human)
mitogen-activated protein kinase p38 bindingcGMP-dependent protein kinase 1 Homo sapiens (human)
protein serine kinase activitycGMP-dependent protein kinase 1 Homo sapiens (human)
RNA bindingCyclin-dependent kinase 13Homo sapiens (human)
protein kinase activityCyclin-dependent kinase 13Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 13Homo sapiens (human)
protein bindingCyclin-dependent kinase 13Homo sapiens (human)
ATP bindingCyclin-dependent kinase 13Homo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityCyclin-dependent kinase 13Homo sapiens (human)
protein kinase bindingCyclin-dependent kinase 13Homo sapiens (human)
cyclin bindingCyclin-dependent kinase 13Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 13Homo sapiens (human)
K63-linked polyubiquitin modification-dependent protein bindingInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
protein serine/threonine kinase activityInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
protein bindingInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
ATP bindingInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
IkappaB kinase activityInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
protein phosphatase bindingInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
ubiquitin protein ligase bindingInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
K48-linked polyubiquitin modification-dependent protein bindingInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
identical protein bindingInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
calmodulin-dependent protein kinase activityProtein-tyrosine kinase 2-betaHomo sapiens (human)
protein tyrosine kinase activityProtein-tyrosine kinase 2-betaHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityProtein-tyrosine kinase 2-betaHomo sapiens (human)
protein bindingProtein-tyrosine kinase 2-betaHomo sapiens (human)
ATP bindingProtein-tyrosine kinase 2-betaHomo sapiens (human)
ubiquitin protein ligase bindingProtein-tyrosine kinase 2-betaHomo sapiens (human)
glutamate receptor bindingProtein-tyrosine kinase 2-betaHomo sapiens (human)
3-phosphoinositide-dependent protein kinase bindingProtein-tyrosine kinase 2-betaHomo sapiens (human)
protein-containing complex bindingProtein-tyrosine kinase 2-betaHomo sapiens (human)
neurotransmitter receptor regulator activityProtein-tyrosine kinase 2-betaHomo sapiens (human)
protein serine/threonine kinase activityMaternal embryonic leucine zipper kinaseHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityMaternal embryonic leucine zipper kinaseHomo sapiens (human)
calcium ion bindingMaternal embryonic leucine zipper kinaseHomo sapiens (human)
protein bindingMaternal embryonic leucine zipper kinaseHomo sapiens (human)
ATP bindingMaternal embryonic leucine zipper kinaseHomo sapiens (human)
lipid bindingMaternal embryonic leucine zipper kinaseHomo sapiens (human)
protein serine kinase activityMaternal embryonic leucine zipper kinaseHomo sapiens (human)
chromatin bindingStructural maintenance of chromosomes protein 1AHomo sapiens (human)
RNA bindingStructural maintenance of chromosomes protein 1AHomo sapiens (human)
protein bindingStructural maintenance of chromosomes protein 1AHomo sapiens (human)
ATP bindingStructural maintenance of chromosomes protein 1AHomo sapiens (human)
ATP hydrolysis activityStructural maintenance of chromosomes protein 1AHomo sapiens (human)
mediator complex bindingStructural maintenance of chromosomes protein 1AHomo sapiens (human)
protein heterodimerization activityStructural maintenance of chromosomes protein 1AHomo sapiens (human)
DNA bindingStructural maintenance of chromosomes protein 1AHomo sapiens (human)
nucleosomal DNA bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
transcription coregulator bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
transcription corepressor activityChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
helicase activityChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
protein bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
ATP bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
zinc ion bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
ATP hydrolysis activityChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
histone deacetylase bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
RNA polymerase II-specific DNA-binding transcription factor bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
ATP-dependent chromatin remodeler activityChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
chromatin bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
DNA bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
histone bindingChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
acyl-CoA oxidase activityPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
protein bindingPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
PDZ domain bindingPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
protein homodimerization activityPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
FAD bindingPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
fatty acid bindingPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
flavin adenine dinucleotide bindingPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
palmitoyl-CoA oxidase activityPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
protein tyrosine kinase activityEphrin type-A receptor 7Homo sapiens (human)
GPI-linked ephrin receptor activityEphrin type-A receptor 7Homo sapiens (human)
protein bindingEphrin type-A receptor 7Homo sapiens (human)
ATP bindingEphrin type-A receptor 7Homo sapiens (human)
axon guidance receptor activityEphrin type-A receptor 7Homo sapiens (human)
growth factor bindingEphrin type-A receptor 7Homo sapiens (human)
chemorepellent activityEphrin type-A receptor 7Homo sapiens (human)
transmembrane-ephrin receptor activityEphrin type-A receptor 7Homo sapiens (human)
delta24(24-1) sterol reductase activityDelta(24)-sterol reductaseHomo sapiens (human)
protein bindingDelta(24)-sterol reductaseHomo sapiens (human)
oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptorDelta(24)-sterol reductaseHomo sapiens (human)
enzyme bindingDelta(24)-sterol reductaseHomo sapiens (human)
peptide antigen bindingDelta(24)-sterol reductaseHomo sapiens (human)
delta24-sterol reductase activityDelta(24)-sterol reductaseHomo sapiens (human)
FAD bindingDelta(24)-sterol reductaseHomo sapiens (human)
magnesium ion bindingRibosomal protein S6 kinase alpha-1Homo sapiens (human)
protein serine/threonine kinase activityRibosomal protein S6 kinase alpha-1Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityRibosomal protein S6 kinase alpha-1Homo sapiens (human)
protein bindingRibosomal protein S6 kinase alpha-1Homo sapiens (human)
ATP bindingRibosomal protein S6 kinase alpha-1Homo sapiens (human)
cysteine-type endopeptidase inhibitor activity involved in apoptotic processRibosomal protein S6 kinase alpha-1Homo sapiens (human)
protein serine kinase activityRibosomal protein S6 kinase alpha-1Homo sapiens (human)
ribosomal protein S6 kinase activityRibosomal protein S6 kinase alpha-1Homo sapiens (human)
protein kinase activityDual specificity testis-specific protein kinase 1Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityDual specificity testis-specific protein kinase 1Homo sapiens (human)
protein tyrosine kinase activityDual specificity testis-specific protein kinase 1Homo sapiens (human)
protein bindingDual specificity testis-specific protein kinase 1Homo sapiens (human)
ATP bindingDual specificity testis-specific protein kinase 1Homo sapiens (human)
protein kinase bindingDual specificity testis-specific protein kinase 1Homo sapiens (human)
metal ion bindingDual specificity testis-specific protein kinase 1Homo sapiens (human)
protein serine kinase activityDual specificity testis-specific protein kinase 1Homo sapiens (human)
protein serine/threonine kinase activityDual specificity testis-specific protein kinase 1Homo sapiens (human)
actin bindingMyosin light chain kinase, smooth muscleHomo sapiens (human)
myosin light chain kinase activityMyosin light chain kinase, smooth muscleHomo sapiens (human)
protein bindingMyosin light chain kinase, smooth muscleHomo sapiens (human)
calmodulin bindingMyosin light chain kinase, smooth muscleHomo sapiens (human)
ATP bindingMyosin light chain kinase, smooth muscleHomo sapiens (human)
metal ion bindingMyosin light chain kinase, smooth muscleHomo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 11Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase 11Homo sapiens (human)
protein bindingMitogen-activated protein kinase 11Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 11Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 11Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase STK11Homo sapiens (human)
p53 bindingSerine/threonine-protein kinase STK11Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase STK11Homo sapiens (human)
protein bindingSerine/threonine-protein kinase STK11Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase STK11Homo sapiens (human)
LRR domain bindingSerine/threonine-protein kinase STK11Homo sapiens (human)
protein kinase activator activitySerine/threonine-protein kinase STK11Homo sapiens (human)
protein-containing complex bindingSerine/threonine-protein kinase STK11Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase STK11Homo sapiens (human)
chromatin bindingSerine/threonine-protein kinase N1Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase N1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase N1Homo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activitySerine/threonine-protein kinase N1Homo sapiens (human)
protein kinase C bindingSerine/threonine-protein kinase N1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase N1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase N1Homo sapiens (human)
nuclear receptor coactivator activitySerine/threonine-protein kinase N1Homo sapiens (human)
small GTPase bindingSerine/threonine-protein kinase N1Homo sapiens (human)
histone H3T11 kinase activitySerine/threonine-protein kinase N1Homo sapiens (human)
histone bindingSerine/threonine-protein kinase N1Homo sapiens (human)
histone deacetylase bindingSerine/threonine-protein kinase N1Homo sapiens (human)
nuclear androgen receptor bindingSerine/threonine-protein kinase N1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase N1Homo sapiens (human)
RNA bindingSerine/threonine-protein kinase N2Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase N2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase N2Homo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activitySerine/threonine-protein kinase N2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase N2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase N2Homo sapiens (human)
kinase activitySerine/threonine-protein kinase N2Homo sapiens (human)
small GTPase bindingSerine/threonine-protein kinase N2Homo sapiens (human)
histone deacetylase bindingSerine/threonine-protein kinase N2Homo sapiens (human)
cadherin bindingSerine/threonine-protein kinase N2Homo sapiens (human)
RNA polymerase bindingSerine/threonine-protein kinase N2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase N2Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 14Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase 14Homo sapiens (human)
MAP kinase kinase activityMitogen-activated protein kinase 14Homo sapiens (human)
protein bindingMitogen-activated protein kinase 14Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 14Homo sapiens (human)
enzyme bindingMitogen-activated protein kinase 14Homo sapiens (human)
protein phosphatase bindingMitogen-activated protein kinase 14Homo sapiens (human)
mitogen-activated protein kinase p38 bindingMitogen-activated protein kinase 14Homo sapiens (human)
NFAT protein bindingMitogen-activated protein kinase 14Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 14Homo sapiens (human)
calmodulin-dependent protein kinase activityCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
ATP bindingCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
protein serine kinase activityCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
calmodulin bindingCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
calcium-dependent protein serine/threonine kinase activityCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
JUN kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
small GTPase bindingMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
mitogen-activated protein kinase kinase bindingMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
mitogen-activated protein kinase kinase kinase bindingMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
identical protein bindingMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
protein homodimerization activityMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityDiscoidin domain-containing receptor 2Homo sapiens (human)
protein bindingDiscoidin domain-containing receptor 2Homo sapiens (human)
collagen bindingDiscoidin domain-containing receptor 2Homo sapiens (human)
ATP bindingDiscoidin domain-containing receptor 2Homo sapiens (human)
protein tyrosine kinase collagen receptor activityDiscoidin domain-containing receptor 2Homo sapiens (human)
protein serine/threonine kinase activityAP2-associated protein kinase 1Homo sapiens (human)
Notch bindingAP2-associated protein kinase 1Homo sapiens (human)
protein bindingAP2-associated protein kinase 1Homo sapiens (human)
ATP bindingAP2-associated protein kinase 1Homo sapiens (human)
AP-2 adaptor complex bindingAP2-associated protein kinase 1Homo sapiens (human)
protein serine kinase activityAP2-associated protein kinase 1Homo sapiens (human)
calmodulin-dependent protein kinase activityMyosin light chain kinase 3Homo sapiens (human)
myosin light chain kinase activityMyosin light chain kinase 3Homo sapiens (human)
protein bindingMyosin light chain kinase 3Homo sapiens (human)
ATP bindingMyosin light chain kinase 3Homo sapiens (human)
protein serine/threonine kinase activityUncharacterized aarF domain-containing protein kinase 5Homo sapiens (human)
protein bindingUncharacterized aarF domain-containing protein kinase 5Homo sapiens (human)
molecular_functionPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
ATP hydrolysis activityPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
ATP-dependent protein folding chaperonePutative heat shock protein HSP 90-beta 2Homo sapiens (human)
disordered domain specific bindingPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
ATP bindingPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
unfolded protein bindingPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
protein bindingRab-like protein 3Homo sapiens (human)
GTP bindingRab-like protein 3Homo sapiens (human)
protein homodimerization activityRab-like protein 3Homo sapiens (human)
GTPase activityRab-like protein 3Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
protein bindingSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
identical protein bindingSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
protein bindingSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
acyl-CoA dehydrogenase activityAcyl-CoA dehydrogenase family member 10Homo sapiens (human)
flavin adenine dinucleotide bindingAcyl-CoA dehydrogenase family member 10Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase ULK3Homo sapiens (human)
protein bindingSerine/threonine-protein kinase ULK3Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase ULK3Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase ULK3Homo sapiens (human)
acyl-CoA dehydrogenase activityAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
long-chain fatty acyl-CoA dehydrogenase activityAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
protein bindingAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
very-long-chain fatty acyl-CoA dehydrogenase activityAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
flavin adenine dinucleotide bindingAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
medium-chain fatty acyl-CoA dehydrogenase activityAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
endonuclease activitySerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
RNA endonuclease activitySerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
unfolded protein bindingSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
RNA bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase MARK2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
lipid bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
protein kinase activator activitySerine/threonine-protein kinase MARK2Homo sapiens (human)
cadherin bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
tau protein bindingSerine/threonine-protein kinase MARK2Homo sapiens (human)
tau-protein kinase activitySerine/threonine-protein kinase MARK2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase MARK2Homo sapiens (human)
chromatin bindingATP-dependent RNA helicase DHX30Homo sapiens (human)
RNA bindingATP-dependent RNA helicase DHX30Homo sapiens (human)
RNA helicase activityATP-dependent RNA helicase DHX30Homo sapiens (human)
double-stranded RNA bindingATP-dependent RNA helicase DHX30Homo sapiens (human)
protein bindingATP-dependent RNA helicase DHX30Homo sapiens (human)
ATP bindingATP-dependent RNA helicase DHX30Homo sapiens (human)
ATP hydrolysis activityATP-dependent RNA helicase DHX30Homo sapiens (human)
G-quadruplex RNA bindingATP-dependent RNA helicase DHX30Homo sapiens (human)
DNA helicase activityATP-dependent RNA helicase DHX30Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase TAO1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase TAO1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase TAO1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase TAO1Homo sapiens (human)
kinase activitySerine/threonine-protein kinase TAO1Homo sapiens (human)
transferase activitySerine/threonine-protein kinase TAO1Homo sapiens (human)
alpha-tubulin bindingSerine/threonine-protein kinase TAO1Homo sapiens (human)
protein serine/threonine kinase activator activitySerine/threonine-protein kinase TAO1Homo sapiens (human)
tau protein bindingSerine/threonine-protein kinase TAO1Homo sapiens (human)
beta-tubulin bindingSerine/threonine-protein kinase TAO1Homo sapiens (human)
tau-protein kinase activitySerine/threonine-protein kinase TAO1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase TAO1Homo sapiens (human)
protein kinase activitySTE20-related kinase adapter protein alphaHomo sapiens (human)
protein bindingSTE20-related kinase adapter protein alphaHomo sapiens (human)
ATP bindingSTE20-related kinase adapter protein alphaHomo sapiens (human)
kinase bindingSTE20-related kinase adapter protein alphaHomo sapiens (human)
protein kinase activator activitySTE20-related kinase adapter protein alphaHomo sapiens (human)
protein serine/threonine kinase activator activitySTE20-related kinase adapter protein alphaHomo sapiens (human)
microfilament motor activityMyosin-14Homo sapiens (human)
actin filament bindingMyosin-14Homo sapiens (human)
calmodulin bindingMyosin-14Homo sapiens (human)
ATP bindingMyosin-14Homo sapiens (human)
protein serine/threonine kinase activityAarF domain-containing protein kinase 1Homo sapiens (human)
ATP bindingAarF domain-containing protein kinase 1Homo sapiens (human)
RNA bindingATP-dependent RNA helicase DDX42Homo sapiens (human)
RNA helicase activityATP-dependent RNA helicase DDX42Homo sapiens (human)
protein bindingATP-dependent RNA helicase DDX42Homo sapiens (human)
ATP bindingATP-dependent RNA helicase DDX42Homo sapiens (human)
ATP hydrolysis activityATP-dependent RNA helicase DDX42Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
MAP kinase kinase kinase kinase activityMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
p53 bindingMAP kinase-activated protein kinase 5Homo sapiens (human)
protein serine/threonine kinase activityMAP kinase-activated protein kinase 5Homo sapiens (human)
MAP kinase kinase activityMAP kinase-activated protein kinase 5Homo sapiens (human)
protein bindingMAP kinase-activated protein kinase 5Homo sapiens (human)
ATP bindingMAP kinase-activated protein kinase 5Homo sapiens (human)
protein serine kinase activityMAP kinase-activated protein kinase 5Homo sapiens (human)
calmodulin-dependent protein kinase activityMAP kinase-activated protein kinase 5Homo sapiens (human)
mitogen-activated protein kinase bindingMAP kinase-activated protein kinase 5Homo sapiens (human)
calcium-dependent protein serine/threonine kinase activityMAP kinase-activated protein kinase 5Homo sapiens (human)
calmodulin bindingMAP kinase-activated protein kinase 5Homo sapiens (human)
protein kinase activityMisshapen-like kinase 1Homo sapiens (human)
protein serine/threonine kinase activityMisshapen-like kinase 1Homo sapiens (human)
protein bindingMisshapen-like kinase 1Homo sapiens (human)
ATP bindingMisshapen-like kinase 1Homo sapiens (human)
protein serine kinase activityMisshapen-like kinase 1Homo sapiens (human)
protein kinase activityAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
protein bindingAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
ATP bindingAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
kinase activityAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
ADP bindingAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
protein bindingPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
ATP bindingPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
1-phosphatidylinositol-4-phosphate 5-kinase activityPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
identical protein bindingPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
1-phosphatidylinositol-5-phosphate 4-kinase activityPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
chromatin bindingMitogen-activated protein kinase 15Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase 15Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase 15Homo sapiens (human)
protein bindingMitogen-activated protein kinase 15Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 15Homo sapiens (human)
kinase activityMitogen-activated protein kinase 15Homo sapiens (human)
SH3 domain bindingMitogen-activated protein kinase 15Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 15Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 15Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase Nek9Homo sapiens (human)
protein bindingSerine/threonine-protein kinase Nek9Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase Nek9Homo sapiens (human)
protein kinase bindingSerine/threonine-protein kinase Nek9Homo sapiens (human)
protein kinase activator activitySerine/threonine-protein kinase Nek9Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase Nek9Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase Nek9Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase Nek7Homo sapiens (human)
protein bindingSerine/threonine-protein kinase Nek7Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase Nek7Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase Nek7Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase Nek7Homo sapiens (human)
molecular function activator activitySerine/threonine-protein kinase Nek7Homo sapiens (human)
DNA bindingATP-dependent RNA helicase DDX1Homo sapiens (human)
chromatin bindingATP-dependent RNA helicase DDX1Homo sapiens (human)
transcription coregulator activityATP-dependent RNA helicase DDX1Homo sapiens (human)
RNA bindingATP-dependent RNA helicase DDX1Homo sapiens (human)
RNA helicase activityATP-dependent RNA helicase DDX1Homo sapiens (human)
double-stranded RNA bindingATP-dependent RNA helicase DDX1Homo sapiens (human)
nuclease activityATP-dependent RNA helicase DDX1Homo sapiens (human)
exonuclease activityATP-dependent RNA helicase DDX1Homo sapiens (human)
protein bindingATP-dependent RNA helicase DDX1Homo sapiens (human)
ATP bindingATP-dependent RNA helicase DDX1Homo sapiens (human)
poly(A) bindingATP-dependent RNA helicase DDX1Homo sapiens (human)
ATP hydrolysis activityATP-dependent RNA helicase DDX1Homo sapiens (human)
DNA/RNA helicase activityATP-dependent RNA helicase DDX1Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
MAP kinase kinase kinase kinase activityMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
protein serine/threonine kinase activityAurora kinase BHomo sapiens (human)
protein serine/threonine kinase activityAurora kinase BHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityAurora kinase BHomo sapiens (human)
protein bindingAurora kinase BHomo sapiens (human)
ATP bindingAurora kinase BHomo sapiens (human)
kinase bindingAurora kinase BHomo sapiens (human)
protein serine kinase activityAurora kinase BHomo sapiens (human)
protein serine/threonine kinase activityMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
protein bindingMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
ATP bindingMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
microtubule bindingMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
cytoskeletal anchor activityMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
gamma-tubulin bindingMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
ubiquitin bindingMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
tau protein bindingMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
tau-protein kinase activityMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
protein serine kinase activityMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase Nek1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase Nek1Homo sapiens (human)
protein tyrosine kinase activitySerine/threonine-protein kinase Nek1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase Nek1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase Nek1Homo sapiens (human)
kinase activitySerine/threonine-protein kinase Nek1Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase Nek1Homo sapiens (human)
14-3-3 protein bindingSerine/threonine-protein kinase Nek1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase Nek1Homo sapiens (human)
calmodulin-dependent protein kinase activityCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
protein tyrosine kinase activityCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
calcium ion bindingCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
calmodulin bindingCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
ATP bindingCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
protein serine kinase activityCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
protein serine/threonine kinase activityCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
p53 bindingEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
protein serine/threonine kinase activityEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
protein bindingEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
ATP bindingEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
hydrolase activityEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
protein serine kinase activityEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
protein serine/threonine kinase activityMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
protein bindingMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
ATP bindingMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
kinase activityMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
metal ion bindingMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
protein serine kinase activityMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
protein kinase activityMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
magnesium ion bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
JUN kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein kinase bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein phosphatase bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein domain specific bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
identical protein bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein homodimerization activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
metal ion bindingMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
eukaryotic translation initiation factor 2alpha kinase activityEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
protein bindingEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
ATP bindingEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
heme bindingEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
protein homodimerization activityEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
protein serine kinase activityEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
RNA bindingNucleolar GTP-binding protein 1Homo sapiens (human)
GTPase activityNucleolar GTP-binding protein 1Homo sapiens (human)
protein bindingNucleolar GTP-binding protein 1Homo sapiens (human)
GTP bindingNucleolar GTP-binding protein 1Homo sapiens (human)
preribosome bindingNucleolar GTP-binding protein 1Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase D2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase D2Homo sapiens (human)
diacylglycerol-dependent serine/threonine kinase activitySerine/threonine-protein kinase D2Homo sapiens (human)
protein kinase C bindingSerine/threonine-protein kinase D2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase D2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase D2Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase D2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase D2Homo sapiens (human)
magnesium ion bindingNUAK family SNF1-like kinase 2Homo sapiens (human)
protein serine/threonine kinase activityNUAK family SNF1-like kinase 2Homo sapiens (human)
protein bindingNUAK family SNF1-like kinase 2Homo sapiens (human)
ATP bindingNUAK family SNF1-like kinase 2Homo sapiens (human)
protein serine kinase activityNUAK family SNF1-like kinase 2Homo sapiens (human)
RNA bindingRNA cytidine acetyltransferaseHomo sapiens (human)
protein bindingRNA cytidine acetyltransferaseHomo sapiens (human)
ATP bindingRNA cytidine acetyltransferaseHomo sapiens (human)
N-acetyltransferase activityRNA cytidine acetyltransferaseHomo sapiens (human)
tRNA N-acetyltransferase activityRNA cytidine acetyltransferaseHomo sapiens (human)
DNA polymerase bindingRNA cytidine acetyltransferaseHomo sapiens (human)
mRNA N-acetyltransferase activityRNA cytidine acetyltransferaseHomo sapiens (human)
tRNA bindingRNA cytidine acetyltransferaseHomo sapiens (human)
rRNA cytidine N-acetyltransferase activityRNA cytidine acetyltransferaseHomo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase SIK2Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase SIK2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase SIK2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase SIK2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase SIK2Homo sapiens (human)
protein serine/threonine kinase activitySTE20-like serine/threonine-protein kinase Homo sapiens (human)
protein bindingSTE20-like serine/threonine-protein kinase Homo sapiens (human)
ATP bindingSTE20-like serine/threonine-protein kinase Homo sapiens (human)
identical protein bindingSTE20-like serine/threonine-protein kinase Homo sapiens (human)
protein homodimerization activitySTE20-like serine/threonine-protein kinase Homo sapiens (human)
cadherin bindingSTE20-like serine/threonine-protein kinase Homo sapiens (human)
protein serine kinase activitySTE20-like serine/threonine-protein kinase Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase TAO3Homo sapiens (human)
protein kinase inhibitor activitySerine/threonine-protein kinase TAO3Homo sapiens (human)
protein bindingSerine/threonine-protein kinase TAO3Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase TAO3Homo sapiens (human)
transferase activitySerine/threonine-protein kinase TAO3Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase TAO3Homo sapiens (human)
magnesium ion bindingdCTP pyrophosphatase 1Homo sapiens (human)
protein bindingdCTP pyrophosphatase 1Homo sapiens (human)
pyrimidine deoxyribonucleotide bindingdCTP pyrophosphatase 1Homo sapiens (human)
identical protein bindingdCTP pyrophosphatase 1Homo sapiens (human)
nucleoside triphosphate diphosphatase activitydCTP pyrophosphatase 1Homo sapiens (human)
dCTP diphosphatase activitydCTP pyrophosphatase 1Homo sapiens (human)
protein serine/threonine kinase activityDual specificity protein kinase CLK4Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityDual specificity protein kinase CLK4Homo sapiens (human)
protein bindingDual specificity protein kinase CLK4Homo sapiens (human)
ATP bindingDual specificity protein kinase CLK4Homo sapiens (human)
protein serine kinase activityDual specificity protein kinase CLK4Homo sapiens (human)
protein tyrosine kinase activityDual specificity protein kinase CLK4Homo sapiens (human)
protein serine/threonine kinase activityCasein kinase I isoform gamma-1Homo sapiens (human)
protein bindingCasein kinase I isoform gamma-1Homo sapiens (human)
ATP bindingCasein kinase I isoform gamma-1Homo sapiens (human)
protein serine kinase activityCasein kinase I isoform gamma-1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase PAK 6Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase PAK 6Homo sapiens (human)
cadherin bindingSerine/threonine-protein kinase PAK 6Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase PAK 6Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase PAK 6Homo sapiens (human)
magnesium ion bindingPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
RNA bindingPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
phenylalanine-tRNA ligase activityPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
protein bindingPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
ATP bindingPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
tRNA bindingIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
aminoacyl-tRNA editing activityIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
isoleucine-tRNA ligase activityIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
ATP bindingIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
protein bindingBMP-2-inducible protein kinaseHomo sapiens (human)
ATP bindingBMP-2-inducible protein kinaseHomo sapiens (human)
protein serine kinase activityBMP-2-inducible protein kinaseHomo sapiens (human)
phosphatase regulator activityBMP-2-inducible protein kinaseHomo sapiens (human)
AP-2 adaptor complex bindingBMP-2-inducible protein kinaseHomo sapiens (human)
protein serine/threonine kinase activityBMP-2-inducible protein kinaseHomo sapiens (human)
protein bindingObg-like ATPase 1Homo sapiens (human)
ATP bindingObg-like ATPase 1Homo sapiens (human)
GTP bindingObg-like ATPase 1Homo sapiens (human)
ATP hydrolysis activityObg-like ATPase 1Homo sapiens (human)
ribosomal large subunit bindingObg-like ATPase 1Homo sapiens (human)
cadherin bindingObg-like ATPase 1Homo sapiens (human)
metal ion bindingObg-like ATPase 1Homo sapiens (human)
protein bindingMidasinHomo sapiens (human)
ATP bindingMidasinHomo sapiens (human)
ATP hydrolysis activityMidasinHomo sapiens (human)
magnesium ion bindingInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
protein serine/threonine kinase activityInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
interleukin-1 receptor bindingInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
protein bindingInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
ATP bindingInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
kinase activityInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
protein kinase bindingInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
protein serine kinase activityInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
magnesium ion bindingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
RNA bindingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
JUN kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
protein kinase activator activityMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
ribosome bindingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
small ribosomal subunit rRNA bindingMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
protein kinase activityCyclin-dependent kinase 12Homo sapiens (human)
cyclin-dependent protein serine/threonine kinase activityCyclin-dependent kinase 12Homo sapiens (human)
protein bindingCyclin-dependent kinase 12Homo sapiens (human)
ATP bindingCyclin-dependent kinase 12Homo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityCyclin-dependent kinase 12Homo sapiens (human)
protein kinase bindingCyclin-dependent kinase 12Homo sapiens (human)
cyclin bindingCyclin-dependent kinase 12Homo sapiens (human)
protein serine kinase activityCyclin-dependent kinase 12Homo sapiens (human)
protein bindingNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
ATP bindingNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
endopeptidase activator activityNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase pim-2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase pim-2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase pim-2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase pim-2Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase 26Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase 26Homo sapiens (human)
protein bindingSerine/threonine-protein kinase 26Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase 26Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase 26Homo sapiens (human)
protein homodimerization activitySerine/threonine-protein kinase 26Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase 26Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase 26Homo sapiens (human)
magnesium ion bindingSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
succinate-CoA ligase (ADP-forming) activitySuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
protein bindingSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
ATP bindingSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase NLKHomo sapiens (human)
protein kinase activitySerine/threonine-protein kinase NLKHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase NLKHomo sapiens (human)
MAP kinase activitySerine/threonine-protein kinase NLKHomo sapiens (human)
protein bindingSerine/threonine-protein kinase NLKHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase NLKHomo sapiens (human)
ubiquitin protein ligase bindingSerine/threonine-protein kinase NLKHomo sapiens (human)
SH2 domain bindingSerine/threonine-protein kinase NLKHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase NLKHomo sapiens (human)
DNA-binding transcription factor bindingSerine/threonine-protein kinase NLKHomo sapiens (human)
AMP-activated protein kinase activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
cAMP-dependent protein kinase inhibitor activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
protein binding5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
ATP binding5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
cAMP-dependent protein kinase regulator activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
phosphorylase kinase regulator activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
protein kinase regulator activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
protein kinase binding5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
protein kinase activator activity5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
ADP binding5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
AMP binding5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
nucleic acid bindingSerine/threonine-protein kinase TBK1Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase TBK1Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase TBK1Homo sapiens (human)
protein bindingSerine/threonine-protein kinase TBK1Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase TBK1Homo sapiens (human)
protein phosphatase bindingSerine/threonine-protein kinase TBK1Homo sapiens (human)
identical protein bindingSerine/threonine-protein kinase TBK1Homo sapiens (human)
phosphoprotein bindingSerine/threonine-protein kinase TBK1Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase TBK1Homo sapiens (human)
protein bindingSeptin-9Homo sapiens (human)
GTP bindingSeptin-9Homo sapiens (human)
cadherin bindingSeptin-9Homo sapiens (human)
GTPase activitySeptin-9Homo sapiens (human)
molecular adaptor activitySeptin-9Homo sapiens (human)
magnesium ion bindingRibosomal protein S6 kinase alpha-6Homo sapiens (human)
protein kinase activityRibosomal protein S6 kinase alpha-6Homo sapiens (human)
protein bindingRibosomal protein S6 kinase alpha-6Homo sapiens (human)
ATP bindingRibosomal protein S6 kinase alpha-6Homo sapiens (human)
protein serine kinase activityRibosomal protein S6 kinase alpha-6Homo sapiens (human)
ribosomal protein S6 kinase activityRibosomal protein S6 kinase alpha-6Homo sapiens (human)
protein kinase activityTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
protein serine/threonine kinase activityTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
protein bindingTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
ATP bindingTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
protein serine kinase activityTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase TAO2Homo sapiens (human)
MAP kinase kinase kinase activitySerine/threonine-protein kinase TAO2Homo sapiens (human)
protein bindingSerine/threonine-protein kinase TAO2Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase TAO2Homo sapiens (human)
mitogen-activated protein kinase kinase bindingSerine/threonine-protein kinase TAO2Homo sapiens (human)
neuropilin bindingSerine/threonine-protein kinase TAO2Homo sapiens (human)
protein serine/threonine kinase activator activitySerine/threonine-protein kinase TAO2Homo sapiens (human)
tau protein bindingSerine/threonine-protein kinase TAO2Homo sapiens (human)
tau-protein kinase activitySerine/threonine-protein kinase TAO2Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase TAO2Homo sapiens (human)
protein tyrosine kinase activityALK tyrosine kinase receptorHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activityALK tyrosine kinase receptorHomo sapiens (human)
protein bindingALK tyrosine kinase receptorHomo sapiens (human)
ATP bindingALK tyrosine kinase receptorHomo sapiens (human)
heparin bindingALK tyrosine kinase receptorHomo sapiens (human)
receptor signaling protein tyrosine kinase activator activityALK tyrosine kinase receptorHomo sapiens (human)
identical protein bindingALK tyrosine kinase receptorHomo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase ICKHomo sapiens (human)
protein kinase activitySerine/threonine-protein kinase ICKHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase ICKHomo sapiens (human)
protein bindingSerine/threonine-protein kinase ICKHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase ICKHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase ICKHomo sapiens (human)
protein kinase activityRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine kinase activityRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
protein bindingRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
ATP bindingRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
protein serine kinase activityRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase 38-likeHomo sapiens (human)
actin bindingSerine/threonine-protein kinase 38-likeHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase 38-likeHomo sapiens (human)
protein bindingSerine/threonine-protein kinase 38-likeHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase 38-likeHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase 38-likeHomo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase SIK3Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase SIK3Homo sapiens (human)
protein bindingSerine/threonine-protein kinase SIK3Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase SIK3Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase SIK3Homo sapiens (human)
tau-protein kinase activitySerine/threonine-protein kinase SIK3Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
protein kinase bindingMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
metal ion bindingMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
MAP kinase kinase kinase kinase activityMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
transcription coactivator activityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein kinase activityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein serine/threonine kinase activityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein bindingReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
ATP bindingReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
identical protein bindingReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein-containing complex bindingReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein serine kinase activityReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
magnesium ion bindingSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
protein kinase activitySerine/threonine-protein kinase MRCK betaHomo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase MRCK betaHomo sapiens (human)
ATP bindingSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
small GTPase bindingSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
protein-containing complex bindingSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase MRCK betaHomo sapiens (human)
magnesium ion bindingInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein serine/threonine kinase activityInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein bindingInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
ATP bindingInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein kinase bindingInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein homodimerization activityInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein heterodimerization activityInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
protein kinase activitySerine/threonine-protein kinase 24Homo sapiens (human)
protein serine/threonine kinase activitySerine/threonine-protein kinase 24Homo sapiens (human)
protein bindingSerine/threonine-protein kinase 24Homo sapiens (human)
ATP bindingSerine/threonine-protein kinase 24Homo sapiens (human)
cadherin bindingSerine/threonine-protein kinase 24Homo sapiens (human)
metal ion bindingSerine/threonine-protein kinase 24Homo sapiens (human)
protein serine kinase activitySerine/threonine-protein kinase 24Homo sapiens (human)
protein kinase activityCasein kinase I isoform gamma-3Homo sapiens (human)
protein serine/threonine kinase activityCasein kinase I isoform gamma-3Homo sapiens (human)
ATP bindingCasein kinase I isoform gamma-3Homo sapiens (human)
protein serine kinase activityCasein kinase I isoform gamma-3Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
metal ion bindingMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Ceullar Components (396)

Processvia Protein(s)Taxonomy
plasma membraneBone morphogenetic protein receptor type-1BHomo sapiens (human)
dendriteBone morphogenetic protein receptor type-1BHomo sapiens (human)
neuronal cell bodyBone morphogenetic protein receptor type-1BHomo sapiens (human)
receptor complexBone morphogenetic protein receptor type-1BHomo sapiens (human)
HFE-transferrin receptor complexBone morphogenetic protein receptor type-1BHomo sapiens (human)
plasma membraneBone morphogenetic protein receptor type-1BHomo sapiens (human)
plasma membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
extracellular regionMembrane-associated progesterone receptor component 1Homo sapiens (human)
mitochondrial outer membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
endoplasmic reticulumMembrane-associated progesterone receptor component 1Homo sapiens (human)
plasma membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
smooth endoplasmic reticulum membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
specific granule membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
neuron projectionMembrane-associated progesterone receptor component 1Homo sapiens (human)
neuronal cell bodyMembrane-associated progesterone receptor component 1Homo sapiens (human)
cell bodyMembrane-associated progesterone receptor component 1Homo sapiens (human)
synapseMembrane-associated progesterone receptor component 1Homo sapiens (human)
endoplasmic reticulumMembrane-associated progesterone receptor component 1Homo sapiens (human)
endomembrane systemMembrane-associated progesterone receptor component 1Homo sapiens (human)
membraneMembrane-associated progesterone receptor component 1Homo sapiens (human)
XY bodySerine/threonine-protein kinase PLK4Homo sapiens (human)
nucleolusSerine/threonine-protein kinase PLK4Homo sapiens (human)
centrosomeSerine/threonine-protein kinase PLK4Homo sapiens (human)
centrioleSerine/threonine-protein kinase PLK4Homo sapiens (human)
cytosolSerine/threonine-protein kinase PLK4Homo sapiens (human)
cleavage furrowSerine/threonine-protein kinase PLK4Homo sapiens (human)
deuterosomeSerine/threonine-protein kinase PLK4Homo sapiens (human)
procentrioleSerine/threonine-protein kinase PLK4Homo sapiens (human)
procentriole replication complexSerine/threonine-protein kinase PLK4Homo sapiens (human)
nucleusSerine/threonine-protein kinase PLK4Homo sapiens (human)
eukaryotic translation initiation factor 3 complexATP-dependent RNA helicase DDX3XHomo sapiens (human)
cytosolic small ribosomal subunitATP-dependent RNA helicase DDX3XHomo sapiens (human)
cytoplasmATP-dependent RNA helicase DDX3XHomo sapiens (human)
extracellular regionATP-dependent RNA helicase DDX3XHomo sapiens (human)
nucleusATP-dependent RNA helicase DDX3XHomo sapiens (human)
nucleoplasmATP-dependent RNA helicase DDX3XHomo sapiens (human)
cytoplasmATP-dependent RNA helicase DDX3XHomo sapiens (human)
centrosomeATP-dependent RNA helicase DDX3XHomo sapiens (human)
cytosolATP-dependent RNA helicase DDX3XHomo sapiens (human)
plasma membraneATP-dependent RNA helicase DDX3XHomo sapiens (human)
cytoplasmic stress granuleATP-dependent RNA helicase DDX3XHomo sapiens (human)
lamellipodiumATP-dependent RNA helicase DDX3XHomo sapiens (human)
cell leading edgeATP-dependent RNA helicase DDX3XHomo sapiens (human)
secretory granule lumenATP-dependent RNA helicase DDX3XHomo sapiens (human)
extracellular exosomeATP-dependent RNA helicase DDX3XHomo sapiens (human)
ficolin-1-rich granule lumenATP-dependent RNA helicase DDX3XHomo sapiens (human)
NLRP3 inflammasome complexATP-dependent RNA helicase DDX3XHomo sapiens (human)
nucleusATP-dependent RNA helicase DDX3XHomo sapiens (human)
P granuleATP-dependent RNA helicase DDX3XHomo sapiens (human)
extracellular regionPyridoxal kinaseHomo sapiens (human)
nucleusPyridoxal kinaseHomo sapiens (human)
nucleoplasmPyridoxal kinaseHomo sapiens (human)
cytosolPyridoxal kinaseHomo sapiens (human)
secretory granule lumenPyridoxal kinaseHomo sapiens (human)
specific granule lumenPyridoxal kinaseHomo sapiens (human)
extracellular exosomePyridoxal kinaseHomo sapiens (human)
cytosolPyridoxal kinaseHomo sapiens (human)
cytosolCitron Rho-interacting kinaseHomo sapiens (human)
membraneCitron Rho-interacting kinaseHomo sapiens (human)
chromosome, telomeric regionSerine/threonine-protein kinase Chk1Homo sapiens (human)
condensed nuclear chromosomeSerine/threonine-protein kinase Chk1Homo sapiens (human)
extracellular spaceSerine/threonine-protein kinase Chk1Homo sapiens (human)
nucleusSerine/threonine-protein kinase Chk1Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase Chk1Homo sapiens (human)
replication forkSerine/threonine-protein kinase Chk1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase Chk1Homo sapiens (human)
centrosomeSerine/threonine-protein kinase Chk1Homo sapiens (human)
cytosolSerine/threonine-protein kinase Chk1Homo sapiens (human)
intracellular membrane-bounded organelleSerine/threonine-protein kinase Chk1Homo sapiens (human)
chromatinSerine/threonine-protein kinase Chk1Homo sapiens (human)
protein-containing complexSerine/threonine-protein kinase Chk1Homo sapiens (human)
nucleusSerine/threonine-protein kinase Chk1Homo sapiens (human)
spindle microtubuleAurora kinase AHomo sapiens (human)
nucleusAurora kinase AHomo sapiens (human)
nucleoplasmAurora kinase AHomo sapiens (human)
centrosomeAurora kinase AHomo sapiens (human)
centrioleAurora kinase AHomo sapiens (human)
spindleAurora kinase AHomo sapiens (human)
cytosolAurora kinase AHomo sapiens (human)
postsynaptic densityAurora kinase AHomo sapiens (human)
microtubule cytoskeletonAurora kinase AHomo sapiens (human)
basolateral plasma membraneAurora kinase AHomo sapiens (human)
midbodyAurora kinase AHomo sapiens (human)
spindle pole centrosomeAurora kinase AHomo sapiens (human)
ciliary basal bodyAurora kinase AHomo sapiens (human)
germinal vesicleAurora kinase AHomo sapiens (human)
axon hillockAurora kinase AHomo sapiens (human)
pronucleusAurora kinase AHomo sapiens (human)
perinuclear region of cytoplasmAurora kinase AHomo sapiens (human)
mitotic spindleAurora kinase AHomo sapiens (human)
meiotic spindleAurora kinase AHomo sapiens (human)
mitotic spindle poleAurora kinase AHomo sapiens (human)
glutamatergic synapseAurora kinase AHomo sapiens (human)
spindle pole centrosomeAurora kinase AHomo sapiens (human)
chromosome passenger complexAurora kinase AHomo sapiens (human)
spindle midzoneAurora kinase AHomo sapiens (human)
kinetochoreAurora kinase AHomo sapiens (human)
Golgi apparatusCyclin-G-associated kinaseHomo sapiens (human)
cytosolCyclin-G-associated kinaseHomo sapiens (human)
focal adhesionCyclin-G-associated kinaseHomo sapiens (human)
membraneCyclin-G-associated kinaseHomo sapiens (human)
clathrin-coated vesicleCyclin-G-associated kinaseHomo sapiens (human)
vesicleCyclin-G-associated kinaseHomo sapiens (human)
intracellular membrane-bounded organelleCyclin-G-associated kinaseHomo sapiens (human)
perinuclear region of cytoplasmCyclin-G-associated kinaseHomo sapiens (human)
presynapseCyclin-G-associated kinaseHomo sapiens (human)
vesicleCyclin-G-associated kinaseHomo sapiens (human)
cytoplasmCyclin-G-associated kinaseHomo sapiens (human)
intracellular membrane-bounded organelleCyclin-G-associated kinaseHomo sapiens (human)
extracellular regionEphrin type-B receptor 6Homo sapiens (human)
cytosolEphrin type-B receptor 6Homo sapiens (human)
plasma membraneEphrin type-B receptor 6Homo sapiens (human)
plasma membraneEphrin type-B receptor 6Homo sapiens (human)
dendriteEphrin type-B receptor 6Homo sapiens (human)
peroxisomePeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
peroxisomal matrixPeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
cytosolPeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
membranePeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
peroxisomePeroxisomal acyl-coenzyme A oxidase 3Homo sapiens (human)
plasma membraneReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
cytoplasmReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
endoplasmic reticulumReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
cytosolReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
cytoskeletonReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
vesicleReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
protein-containing complexReceptor-interacting serine/threonine-protein kinase 2Homo sapiens (human)
kinetochoreMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
nucleoplasmMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
cytosolMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
membraneMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
intracellular membrane-bounded organelleMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
outer kinetochoreMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
kinetochoreMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
nucleusMitotic checkpoint serine/threonine-protein kinase BUB1Homo sapiens (human)
nucleoplasmDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrionDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial outer membraneDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial inner membraneDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial intermembrane spaceDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
cytosolDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
membraneDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial cristaDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
dendriteDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
axon cytoplasmDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial intermembrane spaceDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
cytoplasmDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
microtubuleDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
mitochondrial membraneDynamin-like 120 kDa protein, mitochondrialHomo sapiens (human)
extrinsic component of plasma membraneTyrosine-protein kinase JAK2Homo sapiens (human)
extrinsic component of cytoplasmic side of plasma membraneTyrosine-protein kinase JAK2Homo sapiens (human)
nucleusTyrosine-protein kinase JAK2Homo sapiens (human)
nucleoplasmTyrosine-protein kinase JAK2Homo sapiens (human)
cytoplasmTyrosine-protein kinase JAK2Homo sapiens (human)
cytosolTyrosine-protein kinase JAK2Homo sapiens (human)
cytoskeletonTyrosine-protein kinase JAK2Homo sapiens (human)
plasma membraneTyrosine-protein kinase JAK2Homo sapiens (human)
caveolaTyrosine-protein kinase JAK2Homo sapiens (human)
focal adhesionTyrosine-protein kinase JAK2Homo sapiens (human)
granulocyte macrophage colony-stimulating factor receptor complexTyrosine-protein kinase JAK2Homo sapiens (human)
endosome lumenTyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-12 receptor complexTyrosine-protein kinase JAK2Homo sapiens (human)
membrane raftTyrosine-protein kinase JAK2Homo sapiens (human)
interleukin-23 receptor complexTyrosine-protein kinase JAK2Homo sapiens (human)
postsynapseTyrosine-protein kinase JAK2Homo sapiens (human)
glutamatergic synapseTyrosine-protein kinase JAK2Homo sapiens (human)
euchromatinTyrosine-protein kinase JAK2Homo sapiens (human)
cytosolTyrosine-protein kinase JAK2Homo sapiens (human)
nucleusEukaryotic translation initiation factor 5BHomo sapiens (human)
cytoplasmEukaryotic translation initiation factor 5BHomo sapiens (human)
cytosolEukaryotic translation initiation factor 5BHomo sapiens (human)
synapseEukaryotic translation initiation factor 5BHomo sapiens (human)
cytoplasmEukaryotic translation initiation factor 5BHomo sapiens (human)
nucleusRho-associated protein kinase 2Homo sapiens (human)
centrosomeRho-associated protein kinase 2Homo sapiens (human)
cytosolRho-associated protein kinase 2Homo sapiens (human)
plasma membraneRho-associated protein kinase 2Homo sapiens (human)
cytoplasmic ribonucleoprotein granuleRho-associated protein kinase 2Homo sapiens (human)
centrosomeRho-associated protein kinase 2Homo sapiens (human)
cytoskeletonRho-associated protein kinase 2Homo sapiens (human)
cytoplasmRho-associated protein kinase 2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase ULK1Homo sapiens (human)
phagophore assembly siteSerine/threonine-protein kinase ULK1Homo sapiens (human)
autophagosome membraneSerine/threonine-protein kinase ULK1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase ULK1Homo sapiens (human)
mitochondrial outer membraneSerine/threonine-protein kinase ULK1Homo sapiens (human)
autophagosomeSerine/threonine-protein kinase ULK1Homo sapiens (human)
endoplasmic reticulum membraneSerine/threonine-protein kinase ULK1Homo sapiens (human)
cytosolSerine/threonine-protein kinase ULK1Homo sapiens (human)
axonSerine/threonine-protein kinase ULK1Homo sapiens (human)
phagophore assembly site membraneSerine/threonine-protein kinase ULK1Homo sapiens (human)
recycling endosomeSerine/threonine-protein kinase ULK1Homo sapiens (human)
omegasome membraneSerine/threonine-protein kinase ULK1Homo sapiens (human)
Atg1/ULK1 kinase complexSerine/threonine-protein kinase ULK1Homo sapiens (human)
cytosolSerine/threonine-protein kinase ULK1Homo sapiens (human)
phagophore assembly siteSerine/threonine-protein kinase ULK1Homo sapiens (human)
autophagosomeSerine/threonine-protein kinase ULK1Homo sapiens (human)
phagophore assembly site membraneSerine/threonine-protein kinase ULK1Homo sapiens (human)
nuclear inner membraneSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
mitochondrionSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
endoplasmic reticulumSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
endoplasmic reticulum membraneSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
Ire1 complexSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
AIP1-IRE1 complexSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
IRE1-TRAF2-ASK1 complexSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
IRE1-RACK1-PP2A complexSerine/threonine-protein kinase/endoribonuclease IRE1Homo sapiens (human)
nucleusRibosomal protein S6 kinase alpha-5Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-5Homo sapiens (human)
cytoplasmRibosomal protein S6 kinase alpha-5Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-5Homo sapiens (human)
cytoplasmRibosomal protein S6 kinase alpha-5Homo sapiens (human)
nucleusU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
nucleoplasmU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
membraneU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
U4/U6 x U5 tri-snRNP complexU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
spliceosomal complexU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
U5 snRNPU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
U2-type precatalytic spliceosomeU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
U2-type catalytic step 1 spliceosomeU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
catalytic step 2 spliceosomeU5 small nuclear ribonucleoprotein 200 kDa helicaseHomo sapiens (human)
nucleusRibosomal protein S6 kinase alpha-4Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-4Homo sapiens (human)
cytosolRibosomal protein S6 kinase alpha-4Homo sapiens (human)
synapseRibosomal protein S6 kinase alpha-4Homo sapiens (human)
cytoplasmRibosomal protein S6 kinase alpha-4Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-4Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase 16Homo sapiens (human)
Golgi-associated vesicleSerine/threonine-protein kinase 16Homo sapiens (human)
cytosolSerine/threonine-protein kinase 16Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase 16Homo sapiens (human)
perinuclear region of cytoplasmSerine/threonine-protein kinase 16Homo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase 16Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 16Homo sapiens (human)
cytosolSerine/threonine-protein kinase 10Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase 10Homo sapiens (human)
specific granule membraneSerine/threonine-protein kinase 10Homo sapiens (human)
extracellular exosomeSerine/threonine-protein kinase 10Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 10Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase D3Homo sapiens (human)
cytosolSerine/threonine-protein kinase D3Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase D3Homo sapiens (human)
cytosolSerine/threonine-protein kinase D3Homo sapiens (human)
nuclear chromosomeStructural maintenance of chromosomes protein 2Homo sapiens (human)
condensed chromosomeStructural maintenance of chromosomes protein 2Homo sapiens (human)
condensed nuclear chromosomeStructural maintenance of chromosomes protein 2Homo sapiens (human)
condensin complexStructural maintenance of chromosomes protein 2Homo sapiens (human)
nucleusStructural maintenance of chromosomes protein 2Homo sapiens (human)
nucleoplasmStructural maintenance of chromosomes protein 2Homo sapiens (human)
nucleolusStructural maintenance of chromosomes protein 2Homo sapiens (human)
cytoplasmStructural maintenance of chromosomes protein 2Homo sapiens (human)
cytosolStructural maintenance of chromosomes protein 2Homo sapiens (human)
extracellular exosomeStructural maintenance of chromosomes protein 2Homo sapiens (human)
condensed chromosomeStructural maintenance of chromosomes protein 2Homo sapiens (human)
chromatinStructural maintenance of chromosomes protein 2Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
focal adhesionMitogen-activated protein kinase kinase kinase kinase 4Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase LATS1Homo sapiens (human)
spindle poleSerine/threonine-protein kinase LATS1Homo sapiens (human)
nucleusSerine/threonine-protein kinase LATS1Homo sapiens (human)
centrosomeSerine/threonine-protein kinase LATS1Homo sapiens (human)
cytosolSerine/threonine-protein kinase LATS1Homo sapiens (human)
midbodySerine/threonine-protein kinase LATS1Homo sapiens (human)
spindle poleSerine/threonine-protein kinase LATS1Homo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase PAK 4Homo sapiens (human)
cytosolSerine/threonine-protein kinase PAK 4Homo sapiens (human)
adherens junctionSerine/threonine-protein kinase PAK 4Homo sapiens (human)
focal adhesionSerine/threonine-protein kinase PAK 4Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase PAK 4Homo sapiens (human)
ruffleTyrosine-protein kinase ABL1Homo sapiens (human)
nucleusTyrosine-protein kinase ABL1Homo sapiens (human)
nucleoplasmTyrosine-protein kinase ABL1Homo sapiens (human)
nucleolusTyrosine-protein kinase ABL1Homo sapiens (human)
cytoplasmTyrosine-protein kinase ABL1Homo sapiens (human)
mitochondrionTyrosine-protein kinase ABL1Homo sapiens (human)
cytosolTyrosine-protein kinase ABL1Homo sapiens (human)
actin cytoskeletonTyrosine-protein kinase ABL1Homo sapiens (human)
nuclear bodyTyrosine-protein kinase ABL1Homo sapiens (human)
dendriteTyrosine-protein kinase ABL1Homo sapiens (human)
growth coneTyrosine-protein kinase ABL1Homo sapiens (human)
nuclear membraneTyrosine-protein kinase ABL1Homo sapiens (human)
neuronal cell bodyTyrosine-protein kinase ABL1Homo sapiens (human)
perinuclear region of cytoplasmTyrosine-protein kinase ABL1Homo sapiens (human)
postsynapseTyrosine-protein kinase ABL1Homo sapiens (human)
protein-containing complexTyrosine-protein kinase ABL1Homo sapiens (human)
plasma membraneTyrosine-protein kinase ABL1Homo sapiens (human)
endosomeEpidermal growth factor receptorHomo sapiens (human)
plasma membraneEpidermal growth factor receptorHomo sapiens (human)
ruffle membraneEpidermal growth factor receptorHomo sapiens (human)
Golgi membraneEpidermal growth factor receptorHomo sapiens (human)
extracellular spaceEpidermal growth factor receptorHomo sapiens (human)
nucleusEpidermal growth factor receptorHomo sapiens (human)
cytoplasmEpidermal growth factor receptorHomo sapiens (human)
endosomeEpidermal growth factor receptorHomo sapiens (human)
endoplasmic reticulum membraneEpidermal growth factor receptorHomo sapiens (human)
plasma membraneEpidermal growth factor receptorHomo sapiens (human)
focal adhesionEpidermal growth factor receptorHomo sapiens (human)
cell surfaceEpidermal growth factor receptorHomo sapiens (human)
endosome membraneEpidermal growth factor receptorHomo sapiens (human)
membraneEpidermal growth factor receptorHomo sapiens (human)
basolateral plasma membraneEpidermal growth factor receptorHomo sapiens (human)
apical plasma membraneEpidermal growth factor receptorHomo sapiens (human)
cell junctionEpidermal growth factor receptorHomo sapiens (human)
clathrin-coated endocytic vesicle membraneEpidermal growth factor receptorHomo sapiens (human)
early endosome membraneEpidermal growth factor receptorHomo sapiens (human)
nuclear membraneEpidermal growth factor receptorHomo sapiens (human)
membrane raftEpidermal growth factor receptorHomo sapiens (human)
perinuclear region of cytoplasmEpidermal growth factor receptorHomo sapiens (human)
multivesicular body, internal vesicle lumenEpidermal growth factor receptorHomo sapiens (human)
intracellular vesicleEpidermal growth factor receptorHomo sapiens (human)
protein-containing complexEpidermal growth factor receptorHomo sapiens (human)
receptor complexEpidermal growth factor receptorHomo sapiens (human)
Shc-EGFR complexEpidermal growth factor receptorHomo sapiens (human)
basal plasma membraneEpidermal growth factor receptorHomo sapiens (human)
extracellular spaceInterferon betaHomo sapiens (human)
extracellular regionInterferon betaHomo sapiens (human)
early endosomeHigh affinity nerve growth factor receptorHomo sapiens (human)
late endosomeHigh affinity nerve growth factor receptorHomo sapiens (human)
plasma membraneHigh affinity nerve growth factor receptorHomo sapiens (human)
cell surfaceHigh affinity nerve growth factor receptorHomo sapiens (human)
endosome membraneHigh affinity nerve growth factor receptorHomo sapiens (human)
dendriteHigh affinity nerve growth factor receptorHomo sapiens (human)
early endosome membraneHigh affinity nerve growth factor receptorHomo sapiens (human)
late endosome membraneHigh affinity nerve growth factor receptorHomo sapiens (human)
neuronal cell bodyHigh affinity nerve growth factor receptorHomo sapiens (human)
recycling endosome membraneHigh affinity nerve growth factor receptorHomo sapiens (human)
protein-containing complexHigh affinity nerve growth factor receptorHomo sapiens (human)
receptor complexHigh affinity nerve growth factor receptorHomo sapiens (human)
axonHigh affinity nerve growth factor receptorHomo sapiens (human)
plasma membraneHigh affinity nerve growth factor receptorHomo sapiens (human)
nucleusADP/ATP translocase 2Homo sapiens (human)
mitochondrionADP/ATP translocase 2Homo sapiens (human)
mitochondrial inner membraneADP/ATP translocase 2Homo sapiens (human)
plasma membraneADP/ATP translocase 2Homo sapiens (human)
membraneADP/ATP translocase 2Homo sapiens (human)
mitochondrial nucleoidADP/ATP translocase 2Homo sapiens (human)
mitochondrial permeability transition pore complexADP/ATP translocase 2Homo sapiens (human)
MMXD complexADP/ATP translocase 2Homo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 1A2Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 1A2Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 1A2Homo sapiens (human)
mitochondrial inner membraneCytochrome P450 2E1Homo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 2E1Homo sapiens (human)
cytoplasmCytochrome P450 2E1Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2E1Homo sapiens (human)
nucleusProtein kinase C beta typeHomo sapiens (human)
nucleoplasmProtein kinase C beta typeHomo sapiens (human)
cytoplasmProtein kinase C beta typeHomo sapiens (human)
centrosomeProtein kinase C beta typeHomo sapiens (human)
cytosolProtein kinase C beta typeHomo sapiens (human)
plasma membraneProtein kinase C beta typeHomo sapiens (human)
brush border membraneProtein kinase C beta typeHomo sapiens (human)
calyx of HeldProtein kinase C beta typeHomo sapiens (human)
extracellular exosomeProtein kinase C beta typeHomo sapiens (human)
presynaptic cytosolProtein kinase C beta typeHomo sapiens (human)
spectrinProtein kinase C beta typeHomo sapiens (human)
nuclear envelopeInsulin receptorHomo sapiens (human)
nuclear lumenInsulin receptorHomo sapiens (human)
lysosomeInsulin receptorHomo sapiens (human)
late endosomeInsulin receptorHomo sapiens (human)
plasma membraneInsulin receptorHomo sapiens (human)
caveolaInsulin receptorHomo sapiens (human)
external side of plasma membraneInsulin receptorHomo sapiens (human)
endosome membraneInsulin receptorHomo sapiens (human)
membraneInsulin receptorHomo sapiens (human)
dendrite membraneInsulin receptorHomo sapiens (human)
neuronal cell body membraneInsulin receptorHomo sapiens (human)
extracellular exosomeInsulin receptorHomo sapiens (human)
insulin receptor complexInsulin receptorHomo sapiens (human)
receptor complexInsulin receptorHomo sapiens (human)
plasma membraneInsulin receptorHomo sapiens (human)
axonInsulin receptorHomo sapiens (human)
pericentriolar materialTyrosine-protein kinase LckHomo sapiens (human)
immunological synapseTyrosine-protein kinase LckHomo sapiens (human)
cytosolTyrosine-protein kinase LckHomo sapiens (human)
plasma membraneTyrosine-protein kinase LckHomo sapiens (human)
membrane raftTyrosine-protein kinase LckHomo sapiens (human)
extracellular exosomeTyrosine-protein kinase LckHomo sapiens (human)
plasma membraneTyrosine-protein kinase LckHomo sapiens (human)
membrane raftTyrosine-protein kinase FynHomo sapiens (human)
dendriteTyrosine-protein kinase FynHomo sapiens (human)
nucleusTyrosine-protein kinase FynHomo sapiens (human)
mitochondrionTyrosine-protein kinase FynHomo sapiens (human)
endosomeTyrosine-protein kinase FynHomo sapiens (human)
cytosolTyrosine-protein kinase FynHomo sapiens (human)
actin filamentTyrosine-protein kinase FynHomo sapiens (human)
plasma membraneTyrosine-protein kinase FynHomo sapiens (human)
postsynaptic densityTyrosine-protein kinase FynHomo sapiens (human)
dendriteTyrosine-protein kinase FynHomo sapiens (human)
perikaryonTyrosine-protein kinase FynHomo sapiens (human)
cell bodyTyrosine-protein kinase FynHomo sapiens (human)
membrane raftTyrosine-protein kinase FynHomo sapiens (human)
perinuclear region of cytoplasmTyrosine-protein kinase FynHomo sapiens (human)
perinuclear endoplasmic reticulumTyrosine-protein kinase FynHomo sapiens (human)
glial cell projectionTyrosine-protein kinase FynHomo sapiens (human)
Schaffer collateral - CA1 synapseTyrosine-protein kinase FynHomo sapiens (human)
plasma membraneTyrosine-protein kinase FynHomo sapiens (human)
mitochondrial matrixCyclin-dependent kinase 1Homo sapiens (human)
chromosome, telomeric regionCyclin-dependent kinase 1Homo sapiens (human)
nucleusCyclin-dependent kinase 1Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 1Homo sapiens (human)
mitochondrionCyclin-dependent kinase 1Homo sapiens (human)
endoplasmic reticulum membraneCyclin-dependent kinase 1Homo sapiens (human)
centrosomeCyclin-dependent kinase 1Homo sapiens (human)
cytosolCyclin-dependent kinase 1Homo sapiens (human)
spindle microtubuleCyclin-dependent kinase 1Homo sapiens (human)
membraneCyclin-dependent kinase 1Homo sapiens (human)
midbodyCyclin-dependent kinase 1Homo sapiens (human)
extracellular exosomeCyclin-dependent kinase 1Homo sapiens (human)
mitotic spindleCyclin-dependent kinase 1Homo sapiens (human)
cyclin A1-CDK1 complexCyclin-dependent kinase 1Homo sapiens (human)
cyclin A2-CDK1 complexCyclin-dependent kinase 1Homo sapiens (human)
cyclin B1-CDK1 complexCyclin-dependent kinase 1Homo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 1Homo sapiens (human)
cytoplasmCyclin-dependent kinase 1Homo sapiens (human)
nucleusCyclin-dependent kinase 1Homo sapiens (human)
extracellular regionGlycogen phosphorylase, liver formHomo sapiens (human)
cytosolGlycogen phosphorylase, liver formHomo sapiens (human)
secretory granule lumenGlycogen phosphorylase, liver formHomo sapiens (human)
extracellular exosomeGlycogen phosphorylase, liver formHomo sapiens (human)
ficolin-1-rich granule lumenGlycogen phosphorylase, liver formHomo sapiens (human)
cytoplasmGlycogen phosphorylase, liver formHomo sapiens (human)
cytoplasmic vesicleTyrosine-protein kinase Fes/FpsHomo sapiens (human)
cytoplasmTyrosine-protein kinase Fes/FpsHomo sapiens (human)
Golgi apparatusTyrosine-protein kinase Fes/FpsHomo sapiens (human)
cytosolTyrosine-protein kinase Fes/FpsHomo sapiens (human)
focal adhesionTyrosine-protein kinase Fes/FpsHomo sapiens (human)
cytoplasmic side of plasma membraneTyrosine-protein kinase Fes/FpsHomo sapiens (human)
microtubule cytoskeletonTyrosine-protein kinase Fes/FpsHomo sapiens (human)
plasma membraneTyrosine-protein kinase Fes/FpsHomo sapiens (human)
nucleoplasmMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
plasma membraneMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
cell surfaceMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
intracellular membrane-bounded organelleMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
CSF1-CSF1R complexMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
receptor complexMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
plasma membraneMacrophage colony-stimulating factor 1 receptorHomo sapiens (human)
extracellular regionAdenine phosphoribosyltransferaseHomo sapiens (human)
nucleoplasmAdenine phosphoribosyltransferaseHomo sapiens (human)
cytoplasmAdenine phosphoribosyltransferaseHomo sapiens (human)
cytosolAdenine phosphoribosyltransferaseHomo sapiens (human)
secretory granule lumenAdenine phosphoribosyltransferaseHomo sapiens (human)
extracellular exosomeAdenine phosphoribosyltransferaseHomo sapiens (human)
cytoplasmAdenine phosphoribosyltransferaseHomo sapiens (human)
Golgi apparatusTyrosine-protein kinase YesHomo sapiens (human)
centrosomeTyrosine-protein kinase YesHomo sapiens (human)
cytosolTyrosine-protein kinase YesHomo sapiens (human)
actin filamentTyrosine-protein kinase YesHomo sapiens (human)
plasma membraneTyrosine-protein kinase YesHomo sapiens (human)
focal adhesionTyrosine-protein kinase YesHomo sapiens (human)
extracellular exosomeTyrosine-protein kinase YesHomo sapiens (human)
plasma membraneTyrosine-protein kinase YesHomo sapiens (human)
plasma membraneTyrosine-protein kinase LynHomo sapiens (human)
cytoplasmic side of plasma membraneTyrosine-protein kinase LynHomo sapiens (human)
nucleusTyrosine-protein kinase LynHomo sapiens (human)
cytoplasmTyrosine-protein kinase LynHomo sapiens (human)
lysosomal membraneTyrosine-protein kinase LynHomo sapiens (human)
Golgi apparatusTyrosine-protein kinase LynHomo sapiens (human)
cytosolTyrosine-protein kinase LynHomo sapiens (human)
plasma membraneTyrosine-protein kinase LynHomo sapiens (human)
adherens junctionTyrosine-protein kinase LynHomo sapiens (human)
mitochondrial cristaTyrosine-protein kinase LynHomo sapiens (human)
endocytic vesicle membraneTyrosine-protein kinase LynHomo sapiens (human)
intracellular membrane-bounded organelleTyrosine-protein kinase LynHomo sapiens (human)
membrane raftTyrosine-protein kinase LynHomo sapiens (human)
perinuclear region of cytoplasmTyrosine-protein kinase LynHomo sapiens (human)
extracellular exosomeTyrosine-protein kinase LynHomo sapiens (human)
glutamatergic synapseTyrosine-protein kinase LynHomo sapiens (human)
postsynaptic specialization, intracellular componentTyrosine-protein kinase LynHomo sapiens (human)
integrin alpha2-beta1 complexTyrosine-protein kinase LynHomo sapiens (human)
plasma membraneProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
early endosomeProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
plasma membraneProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
endosome membraneProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
dendriteProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
neuronal cell bodyProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
receptor complexProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
plasma membrane protein complexProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
axonProto-oncogene tyrosine-protein kinase receptor RetHomo sapiens (human)
plasma membraneInsulin-like growth factor 1 receptorHomo sapiens (human)
caveolaInsulin-like growth factor 1 receptorHomo sapiens (human)
membraneInsulin-like growth factor 1 receptorHomo sapiens (human)
T-tubuleInsulin-like growth factor 1 receptorHomo sapiens (human)
neuronal cell bodyInsulin-like growth factor 1 receptorHomo sapiens (human)
intracellular membrane-bounded organelleInsulin-like growth factor 1 receptorHomo sapiens (human)
alphav-beta3 integrin-IGF-1-IGF1R complexInsulin-like growth factor 1 receptorHomo sapiens (human)
receptor complexInsulin-like growth factor 1 receptorHomo sapiens (human)
protein kinase complexInsulin-like growth factor 1 receptorHomo sapiens (human)
axonInsulin-like growth factor 1 receptorHomo sapiens (human)
plasma membraneInsulin-like growth factor 1 receptorHomo sapiens (human)
insulin receptor complexInsulin-like growth factor 1 receptorHomo sapiens (human)
signal recognition particle receptor complexSignal recognition particle receptor subunit alphaHomo sapiens (human)
endoplasmic reticulum membraneSignal recognition particle receptor subunit alphaHomo sapiens (human)
membraneSignal recognition particle receptor subunit alphaHomo sapiens (human)
extracellular exosomeSignal recognition particle receptor subunit alphaHomo sapiens (human)
endoplasmic reticulum membraneSignal recognition particle receptor subunit alphaHomo sapiens (human)
nucleusCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
mitochondrionCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
mitochondrial inner membraneCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
mitochondrial respiratory chain complex IIICytochrome c1, heme protein, mitochondrialHomo sapiens (human)
membraneCytochrome c1, heme protein, mitochondrialHomo sapiens (human)
extracellular regionHepatocyte growth factor receptorHomo sapiens (human)
plasma membraneHepatocyte growth factor receptorHomo sapiens (human)
basal plasma membraneHepatocyte growth factor receptorHomo sapiens (human)
cell surfaceHepatocyte growth factor receptorHomo sapiens (human)
membraneHepatocyte growth factor receptorHomo sapiens (human)
postsynapseHepatocyte growth factor receptorHomo sapiens (human)
basal plasma membraneHepatocyte growth factor receptorHomo sapiens (human)
plasma membraneHepatocyte growth factor receptorHomo sapiens (human)
receptor complexHepatocyte growth factor receptorHomo sapiens (human)
actin filamentTyrosine-protein kinase HCKHomo sapiens (human)
nucleusTyrosine-protein kinase HCKHomo sapiens (human)
lysosomeTyrosine-protein kinase HCKHomo sapiens (human)
Golgi apparatusTyrosine-protein kinase HCKHomo sapiens (human)
cytosolTyrosine-protein kinase HCKHomo sapiens (human)
plasma membraneTyrosine-protein kinase HCKHomo sapiens (human)
caveolaTyrosine-protein kinase HCKHomo sapiens (human)
focal adhesionTyrosine-protein kinase HCKHomo sapiens (human)
cytoplasmic side of plasma membraneTyrosine-protein kinase HCKHomo sapiens (human)
transport vesicleTyrosine-protein kinase HCKHomo sapiens (human)
cell projectionTyrosine-protein kinase HCKHomo sapiens (human)
intracellular membrane-bounded organelleTyrosine-protein kinase HCKHomo sapiens (human)
plasma membraneTyrosine-protein kinase HCKHomo sapiens (human)
cytoplasmCytochrome P450 3A4Homo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 3A4Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 3A4Homo sapiens (human)
nucleusPlatelet-derived growth factor receptor betaHomo sapiens (human)
cytoplasmPlatelet-derived growth factor receptor betaHomo sapiens (human)
Golgi apparatusPlatelet-derived growth factor receptor betaHomo sapiens (human)
plasma membranePlatelet-derived growth factor receptor betaHomo sapiens (human)
focal adhesionPlatelet-derived growth factor receptor betaHomo sapiens (human)
membranePlatelet-derived growth factor receptor betaHomo sapiens (human)
apical plasma membranePlatelet-derived growth factor receptor betaHomo sapiens (human)
cytoplasmic vesiclePlatelet-derived growth factor receptor betaHomo sapiens (human)
lysosomal lumenPlatelet-derived growth factor receptor betaHomo sapiens (human)
intracellular membrane-bounded organellePlatelet-derived growth factor receptor betaHomo sapiens (human)
plasma membranePlatelet-derived growth factor receptor betaHomo sapiens (human)
receptor complexPlatelet-derived growth factor receptor betaHomo sapiens (human)
cellular_componentSerine/threonine-protein kinase A-RafHomo sapiens (human)
cytosolSerine/threonine-protein kinase A-RafHomo sapiens (human)
cytosolSerine/threonine-protein kinase A-RafHomo sapiens (human)
mitochondrionSerine/threonine-protein kinase A-RafHomo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 2C8Homo sapiens (human)
plasma membraneCytochrome P450 2C8Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2C8Homo sapiens (human)
cytoplasmCytochrome P450 2C8Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2C8Homo sapiens (human)
mitochondrionCytochrome P450 2D6Homo sapiens (human)
endoplasmic reticulumCytochrome P450 2D6Homo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 2D6Homo sapiens (human)
cytoplasmCytochrome P450 2D6Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2D6Homo sapiens (human)
extracellular regionGlycogen phosphorylase, brain formHomo sapiens (human)
cytoplasmGlycogen phosphorylase, brain formHomo sapiens (human)
membraneGlycogen phosphorylase, brain formHomo sapiens (human)
azurophil granule lumenGlycogen phosphorylase, brain formHomo sapiens (human)
extracellular exosomeGlycogen phosphorylase, brain formHomo sapiens (human)
cytoplasmGlycogen phosphorylase, brain formHomo sapiens (human)
cytosolBreakpoint cluster region proteinHomo sapiens (human)
plasma membraneBreakpoint cluster region proteinHomo sapiens (human)
postsynaptic densityBreakpoint cluster region proteinHomo sapiens (human)
membraneBreakpoint cluster region proteinHomo sapiens (human)
axonBreakpoint cluster region proteinHomo sapiens (human)
dendritic spineBreakpoint cluster region proteinHomo sapiens (human)
extracellular exosomeBreakpoint cluster region proteinHomo sapiens (human)
protein-containing complexBreakpoint cluster region proteinHomo sapiens (human)
Schaffer collateral - CA1 synapseBreakpoint cluster region proteinHomo sapiens (human)
glutamatergic synapseBreakpoint cluster region proteinHomo sapiens (human)
membraneBreakpoint cluster region proteinHomo sapiens (human)
nucleusSerine/threonine-protein kinase pim-1Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase pim-1Homo sapiens (human)
nucleolusSerine/threonine-protein kinase pim-1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase pim-1Homo sapiens (human)
cytosolSerine/threonine-protein kinase pim-1Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase pim-1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase pim-1Homo sapiens (human)
extracellular regionFibroblast growth factor receptor 1Homo sapiens (human)
nucleusFibroblast growth factor receptor 1Homo sapiens (human)
cytosolFibroblast growth factor receptor 1Homo sapiens (human)
plasma membraneFibroblast growth factor receptor 1Homo sapiens (human)
membraneFibroblast growth factor receptor 1Homo sapiens (human)
cytoplasmic vesicleFibroblast growth factor receptor 1Homo sapiens (human)
receptor complexFibroblast growth factor receptor 1Homo sapiens (human)
plasma membraneFibroblast growth factor receptor 1Homo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 2C9 Homo sapiens (human)
plasma membraneCytochrome P450 2C9 Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2C9 Homo sapiens (human)
cytoplasmCytochrome P450 2C9 Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2C9 Homo sapiens (human)
nucleusCyclin-dependent kinase 4Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 4Homo sapiens (human)
nucleolusCyclin-dependent kinase 4Homo sapiens (human)
cytosolCyclin-dependent kinase 4Homo sapiens (human)
bicellular tight junctionCyclin-dependent kinase 4Homo sapiens (human)
nuclear membraneCyclin-dependent kinase 4Homo sapiens (human)
cyclin D1-CDK4 complexCyclin-dependent kinase 4Homo sapiens (human)
cyclin D2-CDK4 complexCyclin-dependent kinase 4Homo sapiens (human)
cyclin D3-CDK4 complexCyclin-dependent kinase 4Homo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 4Homo sapiens (human)
chromatinCyclin-dependent kinase 4Homo sapiens (human)
transcription regulator complexCyclin-dependent kinase 4Homo sapiens (human)
nucleusCyclin-dependent kinase 4Homo sapiens (human)
cytoplasmCyclin-dependent kinase 4Homo sapiens (human)
nucleusADP/ATP translocase 3Homo sapiens (human)
mitochondrionADP/ATP translocase 3Homo sapiens (human)
mitochondrial inner membraneADP/ATP translocase 3Homo sapiens (human)
membraneADP/ATP translocase 3Homo sapiens (human)
TIM23 mitochondrial import inner membrane translocase complexADP/ATP translocase 3Homo sapiens (human)
extracellular regionInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
nucleusInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
cytoplasmInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
peroxisomal membraneInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
cytosolInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
membraneInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
secretory granule lumenInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
extracellular exosomeInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
ficolin-1-rich granule lumenInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
cytoplasmInosine-5'-monophosphate dehydrogenase 2Homo sapiens (human)
podosomeProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
nucleoplasmProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cytoplasmProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
mitochondrionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
mitochondrial inner membraneProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
lysosomeProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
late endosomeProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cytosolProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
actin filamentProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
plasma membraneProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
caveolaProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
focal adhesionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
cell junctionProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
ruffle membraneProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
neuronal cell bodyProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
dendritic growth coneProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
membrane raftProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
perinuclear region of cytoplasmProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
extracellular exosomeProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
synaptic membraneProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
glutamatergic synapseProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
postsynaptic specialization, intracellular componentProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
dendritic filopodiumProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
plasma membraneProto-oncogene tyrosine-protein kinase SrcHomo sapiens (human)
axonemecAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
cytoplasmcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
centrosomecAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
cytosolcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
plasma membranecAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
focal adhesioncAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
membranecAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
plasma membrane raftcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
extracellular exosomecAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
ciliary basecAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
cAMP-dependent protein kinase complexcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
nucleotide-activated protein kinase complexcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
protein-containing complexcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
cytosolcAMP-dependent protein kinase type II-alpha regulatory subunitHomo sapiens (human)
nucleusSerine/threonine-protein kinase B-rafHomo sapiens (human)
cytosolSerine/threonine-protein kinase B-rafHomo sapiens (human)
plasma membraneSerine/threonine-protein kinase B-rafHomo sapiens (human)
neuron projectionSerine/threonine-protein kinase B-rafHomo sapiens (human)
intracellular membrane-bounded organelleSerine/threonine-protein kinase B-rafHomo sapiens (human)
cell bodySerine/threonine-protein kinase B-rafHomo sapiens (human)
presynapseSerine/threonine-protein kinase B-rafHomo sapiens (human)
cytosolSerine/threonine-protein kinase B-rafHomo sapiens (human)
mitochondrionSerine/threonine-protein kinase B-rafHomo sapiens (human)
plasma membraneSerine/threonine-protein kinase B-rafHomo sapiens (human)
cytosolPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
phosphorylase kinase complexPhosphorylase b kinase gamma catalytic chain, liver/testis isoformHomo sapiens (human)
nucleoplasmRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
cytosolRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
extracellular exosomeRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
cytosolRibosyldihydronicotinamide dehydrogenase [quinone]Homo sapiens (human)
actin cytoskeletonTyrosine-protein kinase FerHomo sapiens (human)
microtubule cytoskeletonTyrosine-protein kinase FerHomo sapiens (human)
lamellipodiumTyrosine-protein kinase FerHomo sapiens (human)
cell junctionTyrosine-protein kinase FerHomo sapiens (human)
nucleusTyrosine-protein kinase FerHomo sapiens (human)
cytoplasmTyrosine-protein kinase FerHomo sapiens (human)
cytosolTyrosine-protein kinase FerHomo sapiens (human)
adherens junctionTyrosine-protein kinase FerHomo sapiens (human)
cell cortexTyrosine-protein kinase FerHomo sapiens (human)
cytoplasmic side of plasma membraneTyrosine-protein kinase FerHomo sapiens (human)
chromatinTyrosine-protein kinase FerHomo sapiens (human)
plasma membraneTyrosine-protein kinase FerHomo sapiens (human)
ciliary basal bodyProtein kinase C alpha typeHomo sapiens (human)
nucleoplasmProtein kinase C alpha typeHomo sapiens (human)
cytoplasmProtein kinase C alpha typeHomo sapiens (human)
mitochondrionProtein kinase C alpha typeHomo sapiens (human)
endoplasmic reticulumProtein kinase C alpha typeHomo sapiens (human)
cytosolProtein kinase C alpha typeHomo sapiens (human)
plasma membraneProtein kinase C alpha typeHomo sapiens (human)
mitochondrial membraneProtein kinase C alpha typeHomo sapiens (human)
perinuclear region of cytoplasmProtein kinase C alpha typeHomo sapiens (human)
extracellular exosomeProtein kinase C alpha typeHomo sapiens (human)
alphav-beta3 integrin-PKCalpha complexProtein kinase C alpha typeHomo sapiens (human)
axonemecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cytoplasmcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
acrosomal vesiclecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
nucleuscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
nucleoplasmcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cytoplasmcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
mitochondrial matrixcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
centrosomecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cytosolcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
plasma membranecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
nuclear speckcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
neuromuscular junctioncAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
sperm flagellumcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
dendritic spinecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
plasma membrane raftcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
perinuclear region of cytoplasmcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
extracellular exosomecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
ciliary basecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
glutamatergic synapsecAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cAMP-dependent protein kinase complexcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
calcium channel complexcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
cytosolcAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
nucleuscAMP-dependent protein kinase catalytic subunit alphaHomo sapiens (human)
nucleusGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
nucleoplasmGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
cytoplasmGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
spindleGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
cytosolGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
transcription factor TFIIH core complexGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
transcription factor TFIID complexGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
transcription factor TFIIH holo complexGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
CAK-ERCC2 complexGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
MMXD complexGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
nucleusGeneral transcription and DNA repair factor IIH helicase subunit XPDHomo sapiens (human)
PcG protein complexCasein kinase II subunit alpha'Homo sapiens (human)
acrosomal vesicleCasein kinase II subunit alpha'Homo sapiens (human)
nucleusCasein kinase II subunit alpha'Homo sapiens (human)
nucleoplasmCasein kinase II subunit alpha'Homo sapiens (human)
cytosolCasein kinase II subunit alpha'Homo sapiens (human)
protein kinase CK2 complexCasein kinase II subunit alpha'Homo sapiens (human)
chromatinCasein kinase II subunit alpha'Homo sapiens (human)
cytosolCasein kinase II subunit alpha'Homo sapiens (human)
nucleusCasein kinase II subunit alpha'Homo sapiens (human)
Golgi membraneRas-related protein Rab-6AHomo sapiens (human)
acrosomal membraneRas-related protein Rab-6AHomo sapiens (human)
endoplasmic reticulum membraneRas-related protein Rab-6AHomo sapiens (human)
Golgi apparatusRas-related protein Rab-6AHomo sapiens (human)
trans-Golgi networkRas-related protein Rab-6AHomo sapiens (human)
cytosolRas-related protein Rab-6AHomo sapiens (human)
plasma membraneRas-related protein Rab-6AHomo sapiens (human)
membraneRas-related protein Rab-6AHomo sapiens (human)
secretory granule membraneRas-related protein Rab-6AHomo sapiens (human)
cytoplasmic vesicleRas-related protein Rab-6AHomo sapiens (human)
trans-Golgi network membraneRas-related protein Rab-6AHomo sapiens (human)
extracellular exosomeRas-related protein Rab-6AHomo sapiens (human)
endosome to plasma membrane transport vesicleRas-related protein Rab-6AHomo sapiens (human)
Golgi apparatusRas-related protein Rab-6AHomo sapiens (human)
endomembrane systemRas-related protein Rab-6AHomo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 2B6Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2B6Homo sapiens (human)
cytoplasmCytochrome P450 2B6Homo sapiens (human)
plasma membraneEphrin type-A receptor 1Homo sapiens (human)
receptor complexEphrin type-A receptor 1Homo sapiens (human)
plasma membraneEphrin type-A receptor 1Homo sapiens (human)
cytoplasmMultifunctional protein ADE2Homo sapiens (human)
cytosolMultifunctional protein ADE2Homo sapiens (human)
membraneMultifunctional protein ADE2Homo sapiens (human)
extracellular exosomeMultifunctional protein ADE2Homo sapiens (human)
nucleoplasmcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
cytosolcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
ciliary basecAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
cytosolcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
nucleuscAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
cAMP-dependent protein kinase complexcAMP-dependent protein kinase catalytic subunit gammaHomo sapiens (human)
nucleoplasmcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
centrosomecAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
cytosolcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
plasma membranecAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
extracellular exosomecAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
ciliary basecAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
cAMP-dependent protein kinase complexcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
cytosolcAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
nucleuscAMP-dependent protein kinase catalytic subunit betaHomo sapiens (human)
mitochondrial inner membraneFerrochelatase, mitochondrialHomo sapiens (human)
mitochondrial matrixFerrochelatase, mitochondrialHomo sapiens (human)
mitochondrionFerrochelatase, mitochondrialHomo sapiens (human)
nucleoplasmRibosomal protein S6 kinase beta-1Homo sapiens (human)
mitochondrionRibosomal protein S6 kinase beta-1Homo sapiens (human)
mitochondrial outer membraneRibosomal protein S6 kinase beta-1Homo sapiens (human)
cytosolRibosomal protein S6 kinase beta-1Homo sapiens (human)
cell surfaceRibosomal protein S6 kinase beta-1Homo sapiens (human)
neuron projectionRibosomal protein S6 kinase beta-1Homo sapiens (human)
perinuclear region of cytoplasmRibosomal protein S6 kinase beta-1Homo sapiens (human)
postsynapseRibosomal protein S6 kinase beta-1Homo sapiens (human)
glutamatergic synapseRibosomal protein S6 kinase beta-1Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase beta-1Homo sapiens (human)
cytoplasmRibosomal protein S6 kinase beta-1Homo sapiens (human)
cytoplasmTyrosine-protein kinase JAK1Homo sapiens (human)
plasma membraneTyrosine-protein kinase JAK1Homo sapiens (human)
cytoplasmic side of plasma membraneTyrosine-protein kinase JAK1Homo sapiens (human)
extrinsic component of cytoplasmic side of plasma membraneTyrosine-protein kinase JAK1Homo sapiens (human)
nucleusTyrosine-protein kinase JAK1Homo sapiens (human)
cytoplasmTyrosine-protein kinase JAK1Homo sapiens (human)
endosomeTyrosine-protein kinase JAK1Homo sapiens (human)
cytosolTyrosine-protein kinase JAK1Homo sapiens (human)
cytoskeletonTyrosine-protein kinase JAK1Homo sapiens (human)
focal adhesionTyrosine-protein kinase JAK1Homo sapiens (human)
cytosolTyrosine-protein kinase JAK1Homo sapiens (human)
chromosome, telomeric regionCyclin-dependent kinase 2Homo sapiens (human)
condensed chromosomeCyclin-dependent kinase 2Homo sapiens (human)
X chromosomeCyclin-dependent kinase 2Homo sapiens (human)
Y chromosomeCyclin-dependent kinase 2Homo sapiens (human)
male germ cell nucleusCyclin-dependent kinase 2Homo sapiens (human)
nucleusCyclin-dependent kinase 2Homo sapiens (human)
nuclear envelopeCyclin-dependent kinase 2Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 2Homo sapiens (human)
cytoplasmCyclin-dependent kinase 2Homo sapiens (human)
endosomeCyclin-dependent kinase 2Homo sapiens (human)
centrosomeCyclin-dependent kinase 2Homo sapiens (human)
cytosolCyclin-dependent kinase 2Homo sapiens (human)
Cajal bodyCyclin-dependent kinase 2Homo sapiens (human)
cyclin A1-CDK2 complexCyclin-dependent kinase 2Homo sapiens (human)
cyclin A2-CDK2 complexCyclin-dependent kinase 2Homo sapiens (human)
cyclin E1-CDK2 complexCyclin-dependent kinase 2Homo sapiens (human)
cyclin E2-CDK2 complexCyclin-dependent kinase 2Homo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 2Homo sapiens (human)
transcription regulator complexCyclin-dependent kinase 2Homo sapiens (human)
cytoplasmCyclin-dependent kinase 2Homo sapiens (human)
nucleusCyclin-dependent kinase 2Homo sapiens (human)
cytoplasmBeta-adrenergic receptor kinase 1Homo sapiens (human)
cytosolBeta-adrenergic receptor kinase 1Homo sapiens (human)
plasma membraneBeta-adrenergic receptor kinase 1Homo sapiens (human)
ciliumBeta-adrenergic receptor kinase 1Homo sapiens (human)
membraneBeta-adrenergic receptor kinase 1Homo sapiens (human)
presynapseBeta-adrenergic receptor kinase 1Homo sapiens (human)
postsynapseBeta-adrenergic receptor kinase 1Homo sapiens (human)
P-bodyProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
nucleusProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
cytoplasmProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
cytosolProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
cytoplasmic stress granuleProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
membraneProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
cytoplasmic ribonucleoprotein granuleProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
RISC complexProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
cytoplasmic stress granuleProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
P-bodyProbable ATP-dependent RNA helicase DDX6Homo sapiens (human)
nucleusMitogen-activated protein kinase 3 Homo sapiens (human)
nuclear envelopeMitogen-activated protein kinase 3 Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 3 Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 3 Homo sapiens (human)
mitochondrionMitogen-activated protein kinase 3 Homo sapiens (human)
early endosomeMitogen-activated protein kinase 3 Homo sapiens (human)
late endosomeMitogen-activated protein kinase 3 Homo sapiens (human)
endoplasmic reticulum lumenMitogen-activated protein kinase 3 Homo sapiens (human)
Golgi apparatusMitogen-activated protein kinase 3 Homo sapiens (human)
cytosolMitogen-activated protein kinase 3 Homo sapiens (human)
cytoskeletonMitogen-activated protein kinase 3 Homo sapiens (human)
plasma membraneMitogen-activated protein kinase 3 Homo sapiens (human)
caveolaMitogen-activated protein kinase 3 Homo sapiens (human)
focal adhesionMitogen-activated protein kinase 3 Homo sapiens (human)
pseudopodiumMitogen-activated protein kinase 3 Homo sapiens (human)
glutamatergic synapseMitogen-activated protein kinase 3 Homo sapiens (human)
nucleusMitogen-activated protein kinase 3 Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 3 Homo sapiens (human)
cytoplasmMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
cytosolMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
plasma membraneMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
dendriteMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
extracellular exosomeMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
plasma membraneMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
cytoplasmMAP/microtubule affinity-regulating kinase 3Homo sapiens (human)
nucleoplasmDeoxycytidine kinaseHomo sapiens (human)
cytosolDeoxycytidine kinaseHomo sapiens (human)
mitochondrionDeoxycytidine kinaseHomo sapiens (human)
cytoplasmDeoxycytidine kinaseHomo sapiens (human)
extracellular regionMitogen-activated protein kinase 1Homo sapiens (human)
nucleusMitogen-activated protein kinase 1Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 1Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 1Homo sapiens (human)
mitochondrionMitogen-activated protein kinase 1Homo sapiens (human)
early endosomeMitogen-activated protein kinase 1Homo sapiens (human)
late endosomeMitogen-activated protein kinase 1Homo sapiens (human)
endoplasmic reticulum lumenMitogen-activated protein kinase 1Homo sapiens (human)
Golgi apparatusMitogen-activated protein kinase 1Homo sapiens (human)
centrosomeMitogen-activated protein kinase 1Homo sapiens (human)
cytosolMitogen-activated protein kinase 1Homo sapiens (human)
cytoskeletonMitogen-activated protein kinase 1Homo sapiens (human)
plasma membraneMitogen-activated protein kinase 1Homo sapiens (human)
caveolaMitogen-activated protein kinase 1Homo sapiens (human)
focal adhesionMitogen-activated protein kinase 1Homo sapiens (human)
pseudopodiumMitogen-activated protein kinase 1Homo sapiens (human)
azurophil granule lumenMitogen-activated protein kinase 1Homo sapiens (human)
synapseMitogen-activated protein kinase 1Homo sapiens (human)
mitotic spindleMitogen-activated protein kinase 1Homo sapiens (human)
ficolin-1-rich granule lumenMitogen-activated protein kinase 1Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 1Homo sapiens (human)
nucleusMitogen-activated protein kinase 1Homo sapiens (human)
plasma membraneEphrin type-A receptor 2Homo sapiens (human)
focal adhesionEphrin type-A receptor 2Homo sapiens (human)
cell surfaceEphrin type-A receptor 2Homo sapiens (human)
lamellipodiumEphrin type-A receptor 2Homo sapiens (human)
leading edge membraneEphrin type-A receptor 2Homo sapiens (human)
lamellipodium membraneEphrin type-A receptor 2Homo sapiens (human)
ruffle membraneEphrin type-A receptor 2Homo sapiens (human)
tight junctionEphrin type-A receptor 2Homo sapiens (human)
receptor complexEphrin type-A receptor 2Homo sapiens (human)
plasma membraneEphrin type-A receptor 2Homo sapiens (human)
extracellular regionEphrin type-B receptor 2Homo sapiens (human)
nucleoplasmEphrin type-B receptor 2Homo sapiens (human)
cytosolEphrin type-B receptor 2Homo sapiens (human)
plasma membraneEphrin type-B receptor 2Homo sapiens (human)
cell surfaceEphrin type-B receptor 2Homo sapiens (human)
axonEphrin type-B receptor 2Homo sapiens (human)
dendriteEphrin type-B receptor 2Homo sapiens (human)
presynaptic membraneEphrin type-B receptor 2Homo sapiens (human)
neuronal cell bodyEphrin type-B receptor 2Homo sapiens (human)
dendritic spineEphrin type-B receptor 2Homo sapiens (human)
postsynaptic membraneEphrin type-B receptor 2Homo sapiens (human)
hippocampal mossy fiber to CA3 synapseEphrin type-B receptor 2Homo sapiens (human)
postsynapseEphrin type-B receptor 2Homo sapiens (human)
glutamatergic synapseEphrin type-B receptor 2Homo sapiens (human)
plasma membraneEphrin type-B receptor 2Homo sapiens (human)
dendriteEphrin type-B receptor 2Homo sapiens (human)
plasma membraneNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cytoplasmic side of plasma membraneNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
extrinsic component of plasma membraneNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
extrinsic component of cytoplasmic side of plasma membraneNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
nucleusNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cytoplasmNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cytosolNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cytoskeletonNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
plasma membraneNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
interleukin-12 receptor complexNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
extracellular exosomeNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
interleukin-23 receptor complexNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
cytosolNon-receptor tyrosine-protein kinase TYK2Homo sapiens (human)
nucleoplasmUMP-CMP kinase Homo sapiens (human)
nucleolusUMP-CMP kinase Homo sapiens (human)
cytosolUMP-CMP kinase Homo sapiens (human)
extracellular exosomeUMP-CMP kinase Homo sapiens (human)
cytoplasmUMP-CMP kinase Homo sapiens (human)
nucleusUMP-CMP kinase Homo sapiens (human)
nucleusPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
cytosolPhosphatidylethanolamine-binding protein 1Homo sapiens (human)
extracellular exosomePhosphatidylethanolamine-binding protein 1Homo sapiens (human)
nucleusWee1-like protein kinaseHomo sapiens (human)
nucleoplasmWee1-like protein kinaseHomo sapiens (human)
nucleolusWee1-like protein kinaseHomo sapiens (human)
cytoplasmWee1-like protein kinaseHomo sapiens (human)
endoplasmic reticulum membraneHeme oxygenase 2Homo sapiens (human)
plasma membraneHeme oxygenase 2Homo sapiens (human)
membraneHeme oxygenase 2Homo sapiens (human)
specific granule membraneHeme oxygenase 2Homo sapiens (human)
cytosolS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
methionine adenosyltransferase complexS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
cytosolS-adenosylmethionine synthase isoform type-2Homo sapiens (human)
nucleusDnaJ homolog subfamily A member 1Homo sapiens (human)
mitochondrionDnaJ homolog subfamily A member 1Homo sapiens (human)
cytosolDnaJ homolog subfamily A member 1Homo sapiens (human)
microtubule cytoskeletonDnaJ homolog subfamily A member 1Homo sapiens (human)
membraneDnaJ homolog subfamily A member 1Homo sapiens (human)
perinuclear region of cytoplasmDnaJ homolog subfamily A member 1Homo sapiens (human)
extracellular exosomeDnaJ homolog subfamily A member 1Homo sapiens (human)
cytoplasmic side of endoplasmic reticulum membraneDnaJ homolog subfamily A member 1Homo sapiens (human)
cytoplasmDnaJ homolog subfamily A member 1Homo sapiens (human)
cytosolDnaJ homolog subfamily A member 1Homo sapiens (human)
cytoplasmRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
mitochondrial intermembrane spaceRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nucleusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nucleoplasmRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cytoplasmRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
spindleRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cytosolRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
plasma membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell-cell junctionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell cortexRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
microtubule cytoskeletonRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
lamellipodiumRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
vesicleRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
ciliary basal bodyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
postsynapseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glutamatergic synapseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein-containing complexRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nucleusRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
nucleoplasmRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
early endosomeRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
cytosolRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
plasma membraneRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
cell cortexRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
ruffle membraneRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
intracellular membrane-bounded organelleRAC-beta serine/threonine-protein kinaseHomo sapiens (human)
endoplasmic reticulum membraneCytochrome P450 2C19Homo sapiens (human)
plasma membraneCytochrome P450 2C19Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2C19Homo sapiens (human)
intracellular membrane-bounded organelleCytochrome P450 2C19Homo sapiens (human)
cytoplasmCytochrome P450 2C19Homo sapiens (human)
chromosome, telomeric regionDNA replication licensing factor MCM4Homo sapiens (human)
nucleusDNA replication licensing factor MCM4Homo sapiens (human)
nucleoplasmDNA replication licensing factor MCM4Homo sapiens (human)
membraneDNA replication licensing factor MCM4Homo sapiens (human)
MCM complexDNA replication licensing factor MCM4Homo sapiens (human)
CMG complexDNA replication licensing factor MCM4Homo sapiens (human)
nucleusDNA replication licensing factor MCM4Homo sapiens (human)
postsynaptic actin cytoskeletonMyosin-10Homo sapiens (human)
stress fiberMyosin-10Homo sapiens (human)
nucleusMyosin-10Homo sapiens (human)
cytoplasmMyosin-10Homo sapiens (human)
cytosolMyosin-10Homo sapiens (human)
cell cortexMyosin-10Homo sapiens (human)
lamellipodiumMyosin-10Homo sapiens (human)
midbodyMyosin-10Homo sapiens (human)
cleavage furrowMyosin-10Homo sapiens (human)
actomyosinMyosin-10Homo sapiens (human)
extracellular exosomeMyosin-10Homo sapiens (human)
myosin II filamentMyosin-10Homo sapiens (human)
myosin complexMyosin-10Homo sapiens (human)
myosin II complexMyosin-10Homo sapiens (human)
myosin filamentMyosin-10Homo sapiens (human)
cytoplasmMyosin-10Homo sapiens (human)
extracellular regionVascular endothelial growth factor receptor 3Homo sapiens (human)
nucleoplasmVascular endothelial growth factor receptor 3Homo sapiens (human)
cytosolVascular endothelial growth factor receptor 3Homo sapiens (human)
plasma membraneVascular endothelial growth factor receptor 3Homo sapiens (human)
receptor complexVascular endothelial growth factor receptor 3Homo sapiens (human)
plasma membraneVascular endothelial growth factor receptor 3Homo sapiens (human)
extracellular regionDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
nucleusDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
mitochondrionDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
early endosomeDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
late endosomeDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
peroxisomal membraneDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
endoplasmic reticulumDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
Golgi apparatusDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
microtubuleDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
cell-cell junctionDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
focal adhesionDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
cytoplasmic side of plasma membraneDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
perinuclear region of cytoplasmDual specificity mitogen-activated protein kinase kinase 2Homo sapiens (human)
endoplasmic reticulumReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
endoplasmic reticulum lumenReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
plasma membraneReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
endosome membraneReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
receptor complexReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
plasma membraneReceptor-type tyrosine-protein kinase FLT3Homo sapiens (human)
caveolaBone morphogenetic protein receptor type-1AHomo sapiens (human)
plasma membraneBone morphogenetic protein receptor type-1AHomo sapiens (human)
external side of plasma membraneBone morphogenetic protein receptor type-1AHomo sapiens (human)
membraneBone morphogenetic protein receptor type-1AHomo sapiens (human)
dendriteBone morphogenetic protein receptor type-1AHomo sapiens (human)
neuronal cell bodyBone morphogenetic protein receptor type-1AHomo sapiens (human)
HFE-transferrin receptor complexBone morphogenetic protein receptor type-1AHomo sapiens (human)
plasma membraneBone morphogenetic protein receptor type-1AHomo sapiens (human)
receptor complexBone morphogenetic protein receptor type-1AHomo sapiens (human)
cytosolActivin receptor type-1BHomo sapiens (human)
plasma membraneActivin receptor type-1BHomo sapiens (human)
cell surfaceActivin receptor type-1BHomo sapiens (human)
receptor complexActivin receptor type-1BHomo sapiens (human)
activin receptor complexActivin receptor type-1BHomo sapiens (human)
plasma membraneActivin receptor type-1BHomo sapiens (human)
nucleusTGF-beta receptor type-1Homo sapiens (human)
endosomeTGF-beta receptor type-1Homo sapiens (human)
plasma membraneTGF-beta receptor type-1Homo sapiens (human)
bicellular tight junctionTGF-beta receptor type-1Homo sapiens (human)
cell surfaceTGF-beta receptor type-1Homo sapiens (human)
membrane raftTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta ligand-receptor complexTGF-beta receptor type-1Homo sapiens (human)
receptor complexTGF-beta receptor type-1Homo sapiens (human)
plasma membraneTGF-beta receptor type-1Homo sapiens (human)
activin receptor complexTGF-beta receptor type-1Homo sapiens (human)
extracellular regionTGF-beta receptor type-2Homo sapiens (human)
cytosolTGF-beta receptor type-2Homo sapiens (human)
plasma membraneTGF-beta receptor type-2Homo sapiens (human)
caveolaTGF-beta receptor type-2Homo sapiens (human)
external side of plasma membraneTGF-beta receptor type-2Homo sapiens (human)
membraneTGF-beta receptor type-2Homo sapiens (human)
membrane raftTGF-beta receptor type-2Homo sapiens (human)
transforming growth factor beta ligand-receptor complexTGF-beta receptor type-2Homo sapiens (human)
receptor complexTGF-beta receptor type-2Homo sapiens (human)
plasma membraneTGF-beta receptor type-2Homo sapiens (human)
mitochondrionElectron transfer flavoprotein subunit betaHomo sapiens (human)
mitochondrial matrixElectron transfer flavoprotein subunit betaHomo sapiens (human)
electron transfer flavoprotein complexElectron transfer flavoprotein subunit betaHomo sapiens (human)
mitochondrionElectron transfer flavoprotein subunit betaHomo sapiens (human)
cytoplasmTyrosine-protein kinase CSKHomo sapiens (human)
cytosolTyrosine-protein kinase CSKHomo sapiens (human)
plasma membraneTyrosine-protein kinase CSKHomo sapiens (human)
cell-cell junctionTyrosine-protein kinase CSKHomo sapiens (human)
extracellular exosomeTyrosine-protein kinase CSKHomo sapiens (human)
plasma membraneTyrosine-protein kinase CSKHomo sapiens (human)
mitochondrial matrixGlycine--tRNA ligaseHomo sapiens (human)
cytosolGlycine--tRNA ligaseHomo sapiens (human)
secretory granuleGlycine--tRNA ligaseHomo sapiens (human)
axonGlycine--tRNA ligaseHomo sapiens (human)
extracellular exosomeGlycine--tRNA ligaseHomo sapiens (human)
cytoplasmGlycine--tRNA ligaseHomo sapiens (human)
mitochondrionGlycine--tRNA ligaseHomo sapiens (human)
Golgi membraneProtein kinase C iota typeHomo sapiens (human)
nucleusProtein kinase C iota typeHomo sapiens (human)
nucleoplasmProtein kinase C iota typeHomo sapiens (human)
endosomeProtein kinase C iota typeHomo sapiens (human)
cytosolProtein kinase C iota typeHomo sapiens (human)
plasma membraneProtein kinase C iota typeHomo sapiens (human)
brush borderProtein kinase C iota typeHomo sapiens (human)
bicellular tight junctionProtein kinase C iota typeHomo sapiens (human)
microtubule cytoskeletonProtein kinase C iota typeHomo sapiens (human)
apical plasma membraneProtein kinase C iota typeHomo sapiens (human)
cell leading edgeProtein kinase C iota typeHomo sapiens (human)
Schmidt-Lanterman incisureProtein kinase C iota typeHomo sapiens (human)
intercellular bridgeProtein kinase C iota typeHomo sapiens (human)
extracellular exosomeProtein kinase C iota typeHomo sapiens (human)
tight junctionProtein kinase C iota typeHomo sapiens (human)
Schaffer collateral - CA1 synapseProtein kinase C iota typeHomo sapiens (human)
glutamatergic synapseProtein kinase C iota typeHomo sapiens (human)
PAR polarity complexProtein kinase C iota typeHomo sapiens (human)
nuclear exosome (RNase complex)Exosome RNA helicase MTR4Homo sapiens (human)
exosome (RNase complex)Exosome RNA helicase MTR4Homo sapiens (human)
nucleusExosome RNA helicase MTR4Homo sapiens (human)
nucleoplasmExosome RNA helicase MTR4Homo sapiens (human)
nucleolusExosome RNA helicase MTR4Homo sapiens (human)
nuclear speckExosome RNA helicase MTR4Homo sapiens (human)
TRAMP complexExosome RNA helicase MTR4Homo sapiens (human)
catalytic step 2 spliceosomeExosome RNA helicase MTR4Homo sapiens (human)
nucleusExosome RNA helicase MTR4Homo sapiens (human)
cytosolTyrosine-protein kinase TecHomo sapiens (human)
cytoskeletonTyrosine-protein kinase TecHomo sapiens (human)
plasma membraneTyrosine-protein kinase TecHomo sapiens (human)
plasma membraneTyrosine-protein kinase TecHomo sapiens (human)
cytosolTyrosine-protein kinase ABL2Homo sapiens (human)
actin cytoskeletonTyrosine-protein kinase ABL2Homo sapiens (human)
plasma membraneTyrosine-protein kinase ABL2Homo sapiens (human)
extracellular regionTyrosine-protein kinase FRKHomo sapiens (human)
nucleusTyrosine-protein kinase FRKHomo sapiens (human)
nucleoplasmTyrosine-protein kinase FRKHomo sapiens (human)
cytosolTyrosine-protein kinase FRKHomo sapiens (human)
azurophil granule lumenTyrosine-protein kinase FRKHomo sapiens (human)
specific granule lumenTyrosine-protein kinase FRKHomo sapiens (human)
extracellular exosomeTyrosine-protein kinase FRKHomo sapiens (human)
plasma membraneTyrosine-protein kinase FRKHomo sapiens (human)
cytoplasmTyrosine-protein kinase SYKHomo sapiens (human)
nucleusTyrosine-protein kinase SYKHomo sapiens (human)
cytoplasmTyrosine-protein kinase SYKHomo sapiens (human)
cytosolTyrosine-protein kinase SYKHomo sapiens (human)
plasma membraneTyrosine-protein kinase SYKHomo sapiens (human)
early phagosomeTyrosine-protein kinase SYKHomo sapiens (human)
B cell receptor complexTyrosine-protein kinase SYKHomo sapiens (human)
protein-containing complexTyrosine-protein kinase SYKHomo sapiens (human)
T cell receptor complexTyrosine-protein kinase SYKHomo sapiens (human)
plasma membraneTyrosine-protein kinase SYKHomo sapiens (human)
proteasome complex26S proteasome regulatory subunit 6BHomo sapiens (human)
nucleus26S proteasome regulatory subunit 6BHomo sapiens (human)
nucleoplasm26S proteasome regulatory subunit 6BHomo sapiens (human)
cytosol26S proteasome regulatory subunit 6BHomo sapiens (human)
membrane26S proteasome regulatory subunit 6BHomo sapiens (human)
inclusion body26S proteasome regulatory subunit 6BHomo sapiens (human)
synapse26S proteasome regulatory subunit 6BHomo sapiens (human)
proteasome accessory complex26S proteasome regulatory subunit 6BHomo sapiens (human)
cytosolic proteasome complex26S proteasome regulatory subunit 6BHomo sapiens (human)
proteasome regulatory particle, base subcomplex26S proteasome regulatory subunit 6BHomo sapiens (human)
cytoplasmMitogen-activated protein kinase 8Homo sapiens (human)
nucleusMitogen-activated protein kinase 8Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 8Homo sapiens (human)
cytosolMitogen-activated protein kinase 8Homo sapiens (human)
axonMitogen-activated protein kinase 8Homo sapiens (human)
synapseMitogen-activated protein kinase 8Homo sapiens (human)
basal dendriteMitogen-activated protein kinase 8Homo sapiens (human)
nucleusMitogen-activated protein kinase 8Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 9Homo sapiens (human)
mitochondrionMitogen-activated protein kinase 9Homo sapiens (human)
cytosolMitogen-activated protein kinase 9Homo sapiens (human)
plasma membraneMitogen-activated protein kinase 9Homo sapiens (human)
nuclear speckMitogen-activated protein kinase 9Homo sapiens (human)
Schaffer collateral - CA1 synapseMitogen-activated protein kinase 9Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 9Homo sapiens (human)
nucleusMitogen-activated protein kinase 9Homo sapiens (human)
nucleusDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
axonDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
dendrite cytoplasmDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
perikaryonDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cytoplasmDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
nucleoplasmDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
membraneDual specificity mitogen-activated protein kinase kinase 3Homo sapiens (human)
photoreceptor outer segmentPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
photoreceptor inner segmentPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
nucleoplasmPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
lysosomePhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
autophagosomePhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
cytosolPhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
plasma membranePhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
plasma membranePhosphatidylinositol 5-phosphate 4-kinase type-2 alphaHomo sapiens (human)
mRNA cleavage and polyadenylation specificity factor complexCasein kinase I isoform alphaHomo sapiens (human)
keratin filamentCasein kinase I isoform alphaHomo sapiens (human)
kinetochoreCasein kinase I isoform alphaHomo sapiens (human)
centrosomeCasein kinase I isoform alphaHomo sapiens (human)
spindleCasein kinase I isoform alphaHomo sapiens (human)
cytosolCasein kinase I isoform alphaHomo sapiens (human)
ciliumCasein kinase I isoform alphaHomo sapiens (human)
membraneCasein kinase I isoform alphaHomo sapiens (human)
nuclear speckCasein kinase I isoform alphaHomo sapiens (human)
beta-catenin destruction complexCasein kinase I isoform alphaHomo sapiens (human)
ciliary basal bodyCasein kinase I isoform alphaHomo sapiens (human)
cytoplasmCasein kinase I isoform alphaHomo sapiens (human)
nucleusCasein kinase I isoform alphaHomo sapiens (human)
nucleusCasein kinase I isoform deltaHomo sapiens (human)
nucleoplasmCasein kinase I isoform deltaHomo sapiens (human)
Golgi apparatusCasein kinase I isoform deltaHomo sapiens (human)
centrosomeCasein kinase I isoform deltaHomo sapiens (human)
spindleCasein kinase I isoform deltaHomo sapiens (human)
cytosolCasein kinase I isoform deltaHomo sapiens (human)
spindle microtubuleCasein kinase I isoform deltaHomo sapiens (human)
plasma membraneCasein kinase I isoform deltaHomo sapiens (human)
endoplasmic reticulum-Golgi intermediate compartment membraneCasein kinase I isoform deltaHomo sapiens (human)
ciliary basal bodyCasein kinase I isoform deltaHomo sapiens (human)
perinuclear region of cytoplasmCasein kinase I isoform deltaHomo sapiens (human)
nucleusCasein kinase I isoform deltaHomo sapiens (human)
cytoplasmCasein kinase I isoform deltaHomo sapiens (human)
spindle microtubuleCasein kinase I isoform deltaHomo sapiens (human)
nucleusMAP kinase-activated protein kinase 2Homo sapiens (human)
nucleoplasmMAP kinase-activated protein kinase 2Homo sapiens (human)
cytoplasmMAP kinase-activated protein kinase 2Homo sapiens (human)
centrosomeMAP kinase-activated protein kinase 2Homo sapiens (human)
cytosolMAP kinase-activated protein kinase 2Homo sapiens (human)
extracellular exosomeMAP kinase-activated protein kinase 2Homo sapiens (human)
nucleusMAP kinase-activated protein kinase 2Homo sapiens (human)
cytoplasmMAP kinase-activated protein kinase 2Homo sapiens (human)
mitochondrionElongation factor Tu, mitochondrialHomo sapiens (human)
mitochondrial outer membraneElongation factor Tu, mitochondrialHomo sapiens (human)
membraneElongation factor Tu, mitochondrialHomo sapiens (human)
mitochondrial nucleoidElongation factor Tu, mitochondrialHomo sapiens (human)
synapseElongation factor Tu, mitochondrialHomo sapiens (human)
extracellular exosomeElongation factor Tu, mitochondrialHomo sapiens (human)
mitochondrionElongation factor Tu, mitochondrialHomo sapiens (human)
nucleusCholine-phosphate cytidylyltransferase AHomo sapiens (human)
nuclear envelopeCholine-phosphate cytidylyltransferase AHomo sapiens (human)
endoplasmic reticulumCholine-phosphate cytidylyltransferase AHomo sapiens (human)
endoplasmic reticulum membraneCholine-phosphate cytidylyltransferase AHomo sapiens (human)
cytosolCholine-phosphate cytidylyltransferase AHomo sapiens (human)
glycogen granuleCholine-phosphate cytidylyltransferase AHomo sapiens (human)
endoplasmic reticulumCholine-phosphate cytidylyltransferase AHomo sapiens (human)
nucleusCasein kinase I isoform epsilonHomo sapiens (human)
nucleoplasmCasein kinase I isoform epsilonHomo sapiens (human)
cytoplasmCasein kinase I isoform epsilonHomo sapiens (human)
cytosolCasein kinase I isoform epsilonHomo sapiens (human)
growth coneCasein kinase I isoform epsilonHomo sapiens (human)
neuronal cell bodyCasein kinase I isoform epsilonHomo sapiens (human)
ribonucleoprotein complexCasein kinase I isoform epsilonHomo sapiens (human)
cytoplasmCasein kinase I isoform epsilonHomo sapiens (human)
nucleusCasein kinase I isoform epsilonHomo sapiens (human)
nucleoplasmVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
nucleolusVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
mitochondrionVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
mitochondrial inner membraneVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
mitochondrial matrixVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
mitochondrial membraneVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
mitochondrial nucleoidVery long-chain specific acyl-CoA dehydrogenase, mitochondrialHomo sapiens (human)
nucleusDual specificity protein kinase CLK2Homo sapiens (human)
nucleoplasmDual specificity protein kinase CLK2Homo sapiens (human)
nuclear bodyDual specificity protein kinase CLK2Homo sapiens (human)
nuclear speckDual specificity protein kinase CLK2Homo sapiens (human)
nucleusDual specificity protein kinase CLK2Homo sapiens (human)
mitochondrionGlycogen synthase kinase-3 alphaHomo sapiens (human)
cytosolGlycogen synthase kinase-3 alphaHomo sapiens (human)
beta-catenin destruction complexGlycogen synthase kinase-3 alphaHomo sapiens (human)
neuronal cell bodyGlycogen synthase kinase-3 alphaHomo sapiens (human)
apical dendriteGlycogen synthase kinase-3 alphaHomo sapiens (human)
postsynapseGlycogen synthase kinase-3 alphaHomo sapiens (human)
proximal dendriteGlycogen synthase kinase-3 alphaHomo sapiens (human)
cytoplasmGlycogen synthase kinase-3 alphaHomo sapiens (human)
nucleusGlycogen synthase kinase-3 alphaHomo sapiens (human)
axonGlycogen synthase kinase-3 alphaHomo sapiens (human)
cytosolGlycogen synthase kinase-3 alphaHomo sapiens (human)
glutamatergic synapseGlycogen synthase kinase-3 betaHomo sapiens (human)
nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
nucleoplasmGlycogen synthase kinase-3 betaHomo sapiens (human)
cytoplasmGlycogen synthase kinase-3 betaHomo sapiens (human)
mitochondrionGlycogen synthase kinase-3 betaHomo sapiens (human)
centrosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
cytosolGlycogen synthase kinase-3 betaHomo sapiens (human)
plasma membraneGlycogen synthase kinase-3 betaHomo sapiens (human)
axonGlycogen synthase kinase-3 betaHomo sapiens (human)
dendriteGlycogen synthase kinase-3 betaHomo sapiens (human)
beta-catenin destruction complexGlycogen synthase kinase-3 betaHomo sapiens (human)
presynapseGlycogen synthase kinase-3 betaHomo sapiens (human)
postsynapseGlycogen synthase kinase-3 betaHomo sapiens (human)
Wnt signalosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
cytosolGlycogen synthase kinase-3 betaHomo sapiens (human)
axonGlycogen synthase kinase-3 betaHomo sapiens (human)
nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
cytoplasmGlycogen synthase kinase-3 betaHomo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 7Homo sapiens (human)
fibrillar centerCyclin-dependent kinase 7Homo sapiens (human)
male germ cell nucleusCyclin-dependent kinase 7Homo sapiens (human)
nucleusCyclin-dependent kinase 7Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 7Homo sapiens (human)
cytosolCyclin-dependent kinase 7Homo sapiens (human)
plasma membraneCyclin-dependent kinase 7Homo sapiens (human)
perinuclear region of cytoplasmCyclin-dependent kinase 7Homo sapiens (human)
transcription factor TFIIH core complexCyclin-dependent kinase 7Homo sapiens (human)
transcription factor TFIIH holo complexCyclin-dependent kinase 7Homo sapiens (human)
CAK-ERCC2 complexCyclin-dependent kinase 7Homo sapiens (human)
transcription factor TFIIK complexCyclin-dependent kinase 7Homo sapiens (human)
cytoplasmCyclin-dependent kinase 7Homo sapiens (human)
nucleusCyclin-dependent kinase 7Homo sapiens (human)
nucleusCyclin-dependent kinase 9Homo sapiens (human)
nucleusCyclin-dependent kinase 9Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 9Homo sapiens (human)
cyclin/CDK positive transcription elongation factor complexCyclin-dependent kinase 9Homo sapiens (human)
membraneCyclin-dependent kinase 9Homo sapiens (human)
PML bodyCyclin-dependent kinase 9Homo sapiens (human)
cytoplasmic ribonucleoprotein granuleCyclin-dependent kinase 9Homo sapiens (human)
transcription elongation factor complexCyclin-dependent kinase 9Homo sapiens (human)
P-TEFb complexCyclin-dependent kinase 9Homo sapiens (human)
photoreceptor outer segmentRas-related protein Rab-27AHomo sapiens (human)
extracellular regionRas-related protein Rab-27AHomo sapiens (human)
lysosomeRas-related protein Rab-27AHomo sapiens (human)
late endosomeRas-related protein Rab-27AHomo sapiens (human)
cytosolRas-related protein Rab-27AHomo sapiens (human)
dendriteRas-related protein Rab-27AHomo sapiens (human)
multivesicular body membraneRas-related protein Rab-27AHomo sapiens (human)
Weibel-Palade bodyRas-related protein Rab-27AHomo sapiens (human)
melanosome membraneRas-related protein Rab-27AHomo sapiens (human)
specific granule lumenRas-related protein Rab-27AHomo sapiens (human)
melanosomeRas-related protein Rab-27AHomo sapiens (human)
extracellular exosomeRas-related protein Rab-27AHomo sapiens (human)
exocytic vesicleRas-related protein Rab-27AHomo sapiens (human)
exocytic vesicleRas-related protein Rab-27AHomo sapiens (human)
apical plasma membraneRas-related protein Rab-27AHomo sapiens (human)
Golgi apparatusRas-related protein Rab-27AHomo sapiens (human)
secretory granuleRas-related protein Rab-27AHomo sapiens (human)
melanosomeRas-related protein Rab-27AHomo sapiens (human)
cytoplasmInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
cell surfaceInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
nucleoplasmInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
lipid dropletInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
cytosolInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
plasma membraneInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
endosome membraneInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
protein-containing complexInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
nucleusInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
plasma membraneInterleukin-1 receptor-associated kinase 1Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-3Homo sapiens (human)
nucleolusRibosomal protein S6 kinase alpha-3Homo sapiens (human)
cytosolRibosomal protein S6 kinase alpha-3Homo sapiens (human)
synapseRibosomal protein S6 kinase alpha-3Homo sapiens (human)
cytoplasmRibosomal protein S6 kinase alpha-3Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-3Homo sapiens (human)
kinetochoreSerine/threonine-protein kinase Nek2Homo sapiens (human)
kinetochoreSerine/threonine-protein kinase Nek2Homo sapiens (human)
condensed nuclear chromosomeSerine/threonine-protein kinase Nek2Homo sapiens (human)
spindle poleSerine/threonine-protein kinase Nek2Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase Nek2Homo sapiens (human)
nucleolusSerine/threonine-protein kinase Nek2Homo sapiens (human)
centrosomeSerine/threonine-protein kinase Nek2Homo sapiens (human)
cytosolSerine/threonine-protein kinase Nek2Homo sapiens (human)
microtubuleSerine/threonine-protein kinase Nek2Homo sapiens (human)
midbodySerine/threonine-protein kinase Nek2Homo sapiens (human)
protein-containing complexSerine/threonine-protein kinase Nek2Homo sapiens (human)
centrosomeSerine/threonine-protein kinase Nek2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase Nek2Homo sapiens (human)
nucleusSerine/threonine-protein kinase Nek2Homo sapiens (human)
nucleusSerine/threonine-protein kinase Nek3Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase Nek3Homo sapiens (human)
axonSerine/threonine-protein kinase Nek3Homo sapiens (human)
extrinsic component of plasma membraneTyrosine-protein kinase JAK3Homo sapiens (human)
extrinsic component of cytoplasmic side of plasma membraneTyrosine-protein kinase JAK3Homo sapiens (human)
endosomeTyrosine-protein kinase JAK3Homo sapiens (human)
cytosolTyrosine-protein kinase JAK3Homo sapiens (human)
cytoskeletonTyrosine-protein kinase JAK3Homo sapiens (human)
plasma membraneTyrosine-protein kinase JAK3Homo sapiens (human)
cytosolTyrosine-protein kinase JAK3Homo sapiens (human)
cytoplasmDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
nucleoplasmDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
cytoskeletonDual specificity mitogen-activated protein kinase kinase 6Homo sapiens (human)
spindle microtubuleSerine/threonine-protein kinase PLK1Homo sapiens (human)
kinetochoreSerine/threonine-protein kinase PLK1Homo sapiens (human)
synaptonemal complexSerine/threonine-protein kinase PLK1Homo sapiens (human)
spindle poleSerine/threonine-protein kinase PLK1Homo sapiens (human)
nucleusSerine/threonine-protein kinase PLK1Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase PLK1Homo sapiens (human)
centrosomeSerine/threonine-protein kinase PLK1Homo sapiens (human)
centrioleSerine/threonine-protein kinase PLK1Homo sapiens (human)
spindleSerine/threonine-protein kinase PLK1Homo sapiens (human)
cytosolSerine/threonine-protein kinase PLK1Homo sapiens (human)
microtubule cytoskeletonSerine/threonine-protein kinase PLK1Homo sapiens (human)
midbodySerine/threonine-protein kinase PLK1Homo sapiens (human)
centriolar satelliteSerine/threonine-protein kinase PLK1Homo sapiens (human)
spindle midzoneSerine/threonine-protein kinase PLK1Homo sapiens (human)
mitotic spindle poleSerine/threonine-protein kinase PLK1Homo sapiens (human)
chromatinSerine/threonine-protein kinase PLK1Homo sapiens (human)
outer kinetochoreSerine/threonine-protein kinase PLK1Homo sapiens (human)
nucleusSerine/threonine-protein kinase PLK1Homo sapiens (human)
centrosomeSerine/threonine-protein kinase PLK1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase PLK1Homo sapiens (human)
spindle poleSerine/threonine-protein kinase PLK1Homo sapiens (human)
kinetochoreSerine/threonine-protein kinase PLK1Homo sapiens (human)
postsynapseLIM domain kinase 1Homo sapiens (human)
glutamatergic synapseLIM domain kinase 1Homo sapiens (human)
male germ cell nucleusLIM domain kinase 1Homo sapiens (human)
cytoplasmLIM domain kinase 1Homo sapiens (human)
cytosolLIM domain kinase 1Homo sapiens (human)
cytoskeletonLIM domain kinase 1Homo sapiens (human)
focal adhesionLIM domain kinase 1Homo sapiens (human)
membraneLIM domain kinase 1Homo sapiens (human)
nuclear speckLIM domain kinase 1Homo sapiens (human)
lamellipodiumLIM domain kinase 1Homo sapiens (human)
neuron projectionLIM domain kinase 1Homo sapiens (human)
nucleusLIM domain kinase 1Homo sapiens (human)
neuron projectionLIM domain kinase 1Homo sapiens (human)
cytoplasmLIM domain kinase 1Homo sapiens (human)
nucleusLIM domain kinase 2Homo sapiens (human)
cytoplasmLIM domain kinase 2Homo sapiens (human)
cis-Golgi networkLIM domain kinase 2Homo sapiens (human)
centrosomeLIM domain kinase 2Homo sapiens (human)
perinuclear region of cytoplasmLIM domain kinase 2Homo sapiens (human)
mitotic spindleLIM domain kinase 2Homo sapiens (human)
nucleusLIM domain kinase 2Homo sapiens (human)
cytoplasmLIM domain kinase 2Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 10Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 10Homo sapiens (human)
mitochondrionMitogen-activated protein kinase 10Homo sapiens (human)
cytosolMitogen-activated protein kinase 10Homo sapiens (human)
plasma membraneMitogen-activated protein kinase 10Homo sapiens (human)
nucleusMitogen-activated protein kinase 10Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 10Homo sapiens (human)
nucleusTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
cytoplasmTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
cytosolTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
extracellular spaceTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
cytosolTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
nuclear bodyTyrosine--tRNA ligase, cytoplasmicHomo sapiens (human)
nucleus5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
nucleoplasm5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
cytosol5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
membrane5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
nucleotide-activated protein kinase complex5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
nucleus5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
cytoplasm5'-AMP-activated protein kinase subunit gamma-1Homo sapiens (human)
extracellular regionEphrin type-B receptor 3Homo sapiens (human)
cytosolEphrin type-B receptor 3Homo sapiens (human)
plasma membraneEphrin type-B receptor 3Homo sapiens (human)
dendriteEphrin type-B receptor 3Homo sapiens (human)
plasma membraneEphrin type-B receptor 3Homo sapiens (human)
rough endoplasmic reticulumEphrin type-A receptor 5Homo sapiens (human)
plasma membraneEphrin type-A receptor 5Homo sapiens (human)
external side of plasma membraneEphrin type-A receptor 5Homo sapiens (human)
axonEphrin type-A receptor 5Homo sapiens (human)
dendriteEphrin type-A receptor 5Homo sapiens (human)
neuronal cell bodyEphrin type-A receptor 5Homo sapiens (human)
perinuclear region of cytoplasmEphrin type-A receptor 5Homo sapiens (human)
plasma membraneEphrin type-A receptor 5Homo sapiens (human)
dendriteEphrin type-A receptor 5Homo sapiens (human)
extracellular regionEphrin type-B receptor 4Homo sapiens (human)
cytosolEphrin type-B receptor 4Homo sapiens (human)
plasma membraneEphrin type-B receptor 4Homo sapiens (human)
extracellular exosomeEphrin type-B receptor 4Homo sapiens (human)
receptor complexEphrin type-B receptor 4Homo sapiens (human)
plasma membraneEphrin type-B receptor 4Homo sapiens (human)
cytoplasmEphrin type-A receptor 4Homo sapiens (human)
mitochondrial outer membraneEphrin type-A receptor 4Homo sapiens (human)
plasma membraneEphrin type-A receptor 4Homo sapiens (human)
adherens junctionEphrin type-A receptor 4Homo sapiens (human)
cell surfaceEphrin type-A receptor 4Homo sapiens (human)
filopodiumEphrin type-A receptor 4Homo sapiens (human)
axonEphrin type-A receptor 4Homo sapiens (human)
dendriteEphrin type-A receptor 4Homo sapiens (human)
neuromuscular junctionEphrin type-A receptor 4Homo sapiens (human)
early endosome membraneEphrin type-A receptor 4Homo sapiens (human)
presynaptic membraneEphrin type-A receptor 4Homo sapiens (human)
dendritic spineEphrin type-A receptor 4Homo sapiens (human)
dendritic shaftEphrin type-A receptor 4Homo sapiens (human)
perikaryonEphrin type-A receptor 4Homo sapiens (human)
axon terminusEphrin type-A receptor 4Homo sapiens (human)
axonal growth coneEphrin type-A receptor 4Homo sapiens (human)
Schaffer collateral - CA1 synapseEphrin type-A receptor 4Homo sapiens (human)
postsynaptic density membraneEphrin type-A receptor 4Homo sapiens (human)
glutamatergic synapseEphrin type-A receptor 4Homo sapiens (human)
plasma membraneEphrin type-A receptor 4Homo sapiens (human)
dendriteEphrin type-A receptor 4Homo sapiens (human)
mitochondrial intermembrane spaceAdenylate kinase 2, mitochondrialHomo sapiens (human)
extracellular exosomeAdenylate kinase 2, mitochondrialHomo sapiens (human)
sperm mitochondrial sheathAdenylate kinase 2, mitochondrialHomo sapiens (human)
cytoplasmAdenylate kinase 2, mitochondrialHomo sapiens (human)
mitochondrionAdenylate kinase 2, mitochondrialHomo sapiens (human)
nucleoplasmAdenosine kinaseHomo sapiens (human)
cytosolAdenosine kinaseHomo sapiens (human)
plasma membraneAdenosine kinaseHomo sapiens (human)
nucleusAdenosine kinaseHomo sapiens (human)
cytosolAdenosine kinaseHomo sapiens (human)
exocystRas-related protein Rab-10Homo sapiens (human)
plasma membraneRas-related protein Rab-10Homo sapiens (human)
Golgi membraneRas-related protein Rab-10Homo sapiens (human)
endosomeRas-related protein Rab-10Homo sapiens (human)
endoplasmic reticulum membraneRas-related protein Rab-10Homo sapiens (human)
Golgi apparatusRas-related protein Rab-10Homo sapiens (human)
trans-Golgi networkRas-related protein Rab-10Homo sapiens (human)
cytosolRas-related protein Rab-10Homo sapiens (human)
cytoskeletonRas-related protein Rab-10Homo sapiens (human)
plasma membraneRas-related protein Rab-10Homo sapiens (human)
adherens junctionRas-related protein Rab-10Homo sapiens (human)
focal adhesionRas-related protein Rab-10Homo sapiens (human)
ciliumRas-related protein Rab-10Homo sapiens (human)
endosome membraneRas-related protein Rab-10Homo sapiens (human)
cytoplasmic vesicle membraneRas-related protein Rab-10Homo sapiens (human)
secretory granule membraneRas-related protein Rab-10Homo sapiens (human)
phagocytic vesicle membraneRas-related protein Rab-10Homo sapiens (human)
insulin-responsive compartmentRas-related protein Rab-10Homo sapiens (human)
perinuclear region of cytoplasmRas-related protein Rab-10Homo sapiens (human)
recycling endosomeRas-related protein Rab-10Homo sapiens (human)
recycling endosome membraneRas-related protein Rab-10Homo sapiens (human)
extracellular exosomeRas-related protein Rab-10Homo sapiens (human)
exocytic vesicleRas-related protein Rab-10Homo sapiens (human)
endoplasmic reticulum tubular networkRas-related protein Rab-10Homo sapiens (human)
recycling endosomeRas-related protein Rab-10Homo sapiens (human)
secretory vesicleRas-related protein Rab-10Homo sapiens (human)
membraneRas-related protein Rab-10Homo sapiens (human)
Golgi apparatusRas-related protein Rab-10Homo sapiens (human)
nucleusActin-related protein 3Homo sapiens (human)
cytoplasmActin-related protein 3Homo sapiens (human)
cytosolActin-related protein 3Homo sapiens (human)
brush borderActin-related protein 3Homo sapiens (human)
cell-cell junctionActin-related protein 3Homo sapiens (human)
focal adhesionActin-related protein 3Homo sapiens (human)
actin cytoskeletonActin-related protein 3Homo sapiens (human)
membraneActin-related protein 3Homo sapiens (human)
lamellipodiumActin-related protein 3Homo sapiens (human)
site of double-strand breakActin-related protein 3Homo sapiens (human)
extracellular exosomeActin-related protein 3Homo sapiens (human)
Arp2/3 protein complexActin-related protein 3Homo sapiens (human)
extracellular regionActin-related protein 2Homo sapiens (human)
nucleusActin-related protein 2Homo sapiens (human)
cytoplasmActin-related protein 2Homo sapiens (human)
cytosolActin-related protein 2Homo sapiens (human)
focal adhesionActin-related protein 2Homo sapiens (human)
actin cytoskeletonActin-related protein 2Homo sapiens (human)
membraneActin-related protein 2Homo sapiens (human)
actin capActin-related protein 2Homo sapiens (human)
azurophil granule lumenActin-related protein 2Homo sapiens (human)
site of double-strand breakActin-related protein 2Homo sapiens (human)
cell projectionActin-related protein 2Homo sapiens (human)
extracellular exosomeActin-related protein 2Homo sapiens (human)
ficolin-1-rich granule lumenActin-related protein 2Homo sapiens (human)
Arp2/3 protein complexActin-related protein 2Homo sapiens (human)
cell cortexActin-related protein 2Homo sapiens (human)
Flemming bodyGTP-binding nuclear protein RanHomo sapiens (human)
male germ cell nucleusGTP-binding nuclear protein RanHomo sapiens (human)
manchetteGTP-binding nuclear protein RanHomo sapiens (human)
nucleusGTP-binding nuclear protein RanHomo sapiens (human)
nuclear envelopeGTP-binding nuclear protein RanHomo sapiens (human)
nucleoplasmGTP-binding nuclear protein RanHomo sapiens (human)
nucleolusGTP-binding nuclear protein RanHomo sapiens (human)
cytoplasmGTP-binding nuclear protein RanHomo sapiens (human)
centrioleGTP-binding nuclear protein RanHomo sapiens (human)
cytosolGTP-binding nuclear protein RanHomo sapiens (human)
membraneGTP-binding nuclear protein RanHomo sapiens (human)
midbodyGTP-binding nuclear protein RanHomo sapiens (human)
sperm flagellumGTP-binding nuclear protein RanHomo sapiens (human)
melanosomeGTP-binding nuclear protein RanHomo sapiens (human)
recycling endosomeGTP-binding nuclear protein RanHomo sapiens (human)
extracellular exosomeGTP-binding nuclear protein RanHomo sapiens (human)
chromatinGTP-binding nuclear protein RanHomo sapiens (human)
nuclear poreGTP-binding nuclear protein RanHomo sapiens (human)
protein-containing complexGTP-binding nuclear protein RanHomo sapiens (human)
RNA nuclear export complexGTP-binding nuclear protein RanHomo sapiens (human)
nucleusGTP-binding nuclear protein RanHomo sapiens (human)
cytoplasmGTP-binding nuclear protein RanHomo sapiens (human)
actin filamentRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
postsynapseRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
glutamatergic synapseRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
nucleusRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cytoplasmRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
endoplasmic reticulum membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
trans-Golgi networkRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cytosolRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
plasma membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
focal adhesionRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cell cortexRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
lamellipodiumRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
secretory granule membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
ruffle membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cytoplasmic ribonucleoprotein granuleRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
melanosomeRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
NADPH oxidase complexRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
dendritic spineRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
recycling endosome membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
extracellular exosomeRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
ficolin-1-rich granule membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cytoplasmic vesicleRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
plasma membraneRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
dendritic spineRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cytoskeletonRas-related C3 botulinum toxin substrate 1Homo sapiens (human)
cytosolCasein kinase I isoform gamma-2Homo sapiens (human)
cell cortexCasein kinase I isoform gamma-2Homo sapiens (human)
membraneCasein kinase I isoform gamma-2Homo sapiens (human)
cytoplasmCasein kinase I isoform gamma-2Homo sapiens (human)
plasma membraneCasein kinase I isoform gamma-2Homo sapiens (human)
nucleusCasein kinase I isoform gamma-2Homo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 3Homo sapiens (human)
nucleusCyclin-dependent kinase 3Homo sapiens (human)
cytoplasmCyclin-dependent kinase 3Homo sapiens (human)
ruffleCyclin-dependent kinase 6Homo sapiens (human)
nucleusCyclin-dependent kinase 6Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 6Homo sapiens (human)
cytoplasmCyclin-dependent kinase 6Homo sapiens (human)
centrosomeCyclin-dependent kinase 6Homo sapiens (human)
cytosolCyclin-dependent kinase 6Homo sapiens (human)
cyclin D1-CDK6 complexCyclin-dependent kinase 6Homo sapiens (human)
cyclin D3-CDK6 complexCyclin-dependent kinase 6Homo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 6Homo sapiens (human)
cyclin D2-CDK6 complexCyclin-dependent kinase 6Homo sapiens (human)
cytoplasmCyclin-dependent kinase 6Homo sapiens (human)
nucleusCyclin-dependent kinase 6Homo sapiens (human)
microtubuleCyclin-dependent-like kinase 5 Homo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent-like kinase 5 Homo sapiens (human)
nucleusCyclin-dependent-like kinase 5 Homo sapiens (human)
nucleoplasmCyclin-dependent-like kinase 5 Homo sapiens (human)
cytoplasmCyclin-dependent-like kinase 5 Homo sapiens (human)
cytosolCyclin-dependent-like kinase 5 Homo sapiens (human)
plasma membraneCyclin-dependent-like kinase 5 Homo sapiens (human)
postsynaptic densityCyclin-dependent-like kinase 5 Homo sapiens (human)
membraneCyclin-dependent-like kinase 5 Homo sapiens (human)
protein kinase 5 complexCyclin-dependent-like kinase 5 Homo sapiens (human)
lamellipodiumCyclin-dependent-like kinase 5 Homo sapiens (human)
cell junctionCyclin-dependent-like kinase 5 Homo sapiens (human)
filopodiumCyclin-dependent-like kinase 5 Homo sapiens (human)
axonCyclin-dependent-like kinase 5 Homo sapiens (human)
dendriteCyclin-dependent-like kinase 5 Homo sapiens (human)
growth coneCyclin-dependent-like kinase 5 Homo sapiens (human)
neuromuscular junctionCyclin-dependent-like kinase 5 Homo sapiens (human)
neuron projectionCyclin-dependent-like kinase 5 Homo sapiens (human)
neuronal cell bodyCyclin-dependent-like kinase 5 Homo sapiens (human)
perikaryonCyclin-dependent-like kinase 5 Homo sapiens (human)
presynapseCyclin-dependent-like kinase 5 Homo sapiens (human)
nucleusCyclin-dependent-like kinase 5 Homo sapiens (human)
cytoplasmCyclin-dependent-like kinase 5 Homo sapiens (human)
synaptic vesicleCyclin-dependent kinase 16Homo sapiens (human)
cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 16Homo sapiens (human)
cytoplasmCyclin-dependent kinase 16Homo sapiens (human)
cytosolCyclin-dependent kinase 16Homo sapiens (human)
plasma membraneCyclin-dependent kinase 16Homo sapiens (human)
cytoplasmic side of plasma membraneCyclin-dependent kinase 16Homo sapiens (human)
microtubule cytoskeletonCyclin-dependent kinase 16Homo sapiens (human)
neuron projectionCyclin-dependent kinase 16Homo sapiens (human)
cytoplasmCyclin-dependent kinase 16Homo sapiens (human)
nucleusCyclin-dependent kinase 16Homo sapiens (human)
cytoplasmCyclin-dependent kinase 17Homo sapiens (human)
nucleusCyclin-dependent kinase 17Homo sapiens (human)
nucleusATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
cytoplasmATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
cytosolATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
membraneATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
extracellular exosomeATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
membraneATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
6-phosphofructokinase complexATP-dependent 6-phosphofructokinase, platelet typeHomo sapiens (human)
nucleusDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
mitochondrionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
early endosomeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
late endosomeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
endoplasmic reticulumDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
Golgi apparatusDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
centrosomeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
plasma membraneDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
focal adhesionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
nucleolusDNA topoisomerase 2-betaHomo sapiens (human)
heterochromatinDNA topoisomerase 2-betaHomo sapiens (human)
nucleusDNA topoisomerase 2-betaHomo sapiens (human)
nucleoplasmDNA topoisomerase 2-betaHomo sapiens (human)
nucleolusDNA topoisomerase 2-betaHomo sapiens (human)
cytosolDNA topoisomerase 2-betaHomo sapiens (human)
ribonucleoprotein complexDNA topoisomerase 2-betaHomo sapiens (human)
nucleusDNA topoisomerase 2-betaHomo sapiens (human)
immunological synapseProtein kinase C theta typeHomo sapiens (human)
cytosolProtein kinase C theta typeHomo sapiens (human)
plasma membraneProtein kinase C theta typeHomo sapiens (human)
aggresomeProtein kinase C theta typeHomo sapiens (human)
centriolar satelliteProtein kinase C theta typeHomo sapiens (human)
plasma membraneActivin receptor type-1Homo sapiens (human)
apical part of cellActivin receptor type-1Homo sapiens (human)
activin receptor complexActivin receptor type-1Homo sapiens (human)
BMP receptor complexActivin receptor type-1Homo sapiens (human)
plasma membraneActivin receptor type-1Homo sapiens (human)
stress fiberMacrophage-stimulating protein receptorHomo sapiens (human)
vacuoleMacrophage-stimulating protein receptorHomo sapiens (human)
plasma membraneMacrophage-stimulating protein receptorHomo sapiens (human)
cell surfaceMacrophage-stimulating protein receptorHomo sapiens (human)
receptor complexMacrophage-stimulating protein receptorHomo sapiens (human)
plasma membraneMacrophage-stimulating protein receptorHomo sapiens (human)
stress fiberFocal adhesion kinase 1Homo sapiens (human)
nucleusFocal adhesion kinase 1Homo sapiens (human)
cytoplasmFocal adhesion kinase 1Homo sapiens (human)
centrosomeFocal adhesion kinase 1Homo sapiens (human)
cytosolFocal adhesion kinase 1Homo sapiens (human)
cytoskeletonFocal adhesion kinase 1Homo sapiens (human)
plasma membraneFocal adhesion kinase 1Homo sapiens (human)
focal adhesionFocal adhesion kinase 1Homo sapiens (human)
cell cortexFocal adhesion kinase 1Homo sapiens (human)
ciliary basal bodyFocal adhesion kinase 1Homo sapiens (human)
intracellular membrane-bounded organelleFocal adhesion kinase 1Homo sapiens (human)
perinuclear region of cytoplasmFocal adhesion kinase 1Homo sapiens (human)
plasma membraneFocal adhesion kinase 1Homo sapiens (human)
focal adhesionFocal adhesion kinase 1Homo sapiens (human)
dendritic spineFocal adhesion kinase 1Homo sapiens (human)
extracellular regionProtein kinase C delta typeHomo sapiens (human)
nucleusProtein kinase C delta typeHomo sapiens (human)
nucleoplasmProtein kinase C delta typeHomo sapiens (human)
cytoplasmProtein kinase C delta typeHomo sapiens (human)
mitochondrionProtein kinase C delta typeHomo sapiens (human)
endoplasmic reticulumProtein kinase C delta typeHomo sapiens (human)
cytosolProtein kinase C delta typeHomo sapiens (human)
plasma membraneProtein kinase C delta typeHomo sapiens (human)
cell-cell junctionProtein kinase C delta typeHomo sapiens (human)
nuclear matrixProtein kinase C delta typeHomo sapiens (human)
azurophil granule lumenProtein kinase C delta typeHomo sapiens (human)
endolysosomeProtein kinase C delta typeHomo sapiens (human)
perinuclear region of cytoplasmProtein kinase C delta typeHomo sapiens (human)
extracellular exosomeProtein kinase C delta typeHomo sapiens (human)
nucleusTyrosine-protein kinase BTKHomo sapiens (human)
cytoplasmTyrosine-protein kinase BTKHomo sapiens (human)
cytosolTyrosine-protein kinase BTKHomo sapiens (human)
plasma membraneTyrosine-protein kinase BTKHomo sapiens (human)
cytoplasmic vesicleTyrosine-protein kinase BTKHomo sapiens (human)
membrane raftTyrosine-protein kinase BTKHomo sapiens (human)
perinuclear region of cytoplasmTyrosine-protein kinase BTKHomo sapiens (human)
plasma membraneTyrosine-protein kinase BTKHomo sapiens (human)
nucleusActivated CDC42 kinase 1Homo sapiens (human)
cytoplasmActivated CDC42 kinase 1Homo sapiens (human)
endosomeActivated CDC42 kinase 1Homo sapiens (human)
cytosolActivated CDC42 kinase 1Homo sapiens (human)
plasma membraneActivated CDC42 kinase 1Homo sapiens (human)
clathrin-coated pitActivated CDC42 kinase 1Homo sapiens (human)
adherens junctionActivated CDC42 kinase 1Homo sapiens (human)
membraneActivated CDC42 kinase 1Homo sapiens (human)
clathrin-coated vesicleActivated CDC42 kinase 1Homo sapiens (human)
cytoplasmic vesicle membraneActivated CDC42 kinase 1Homo sapiens (human)
intracellular membrane-bounded organelleActivated CDC42 kinase 1Homo sapiens (human)
perinuclear region of cytoplasmActivated CDC42 kinase 1Homo sapiens (human)
cytoophidiumActivated CDC42 kinase 1Homo sapiens (human)
Grb2-EGFR complexActivated CDC42 kinase 1Homo sapiens (human)
plasma membraneActivated CDC42 kinase 1Homo sapiens (human)
extracellular spaceEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
plasma membraneEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
extracellular exosomeEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
receptor complexEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
plasma membraneEpithelial discoidin domain-containing receptor 1Homo sapiens (human)
plasma membranePotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
cell surfacePotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
perinuclear region of cytoplasmPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
voltage-gated potassium channel complexPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
inward rectifier potassium channel complexPotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
plasma membranePotassium voltage-gated channel subfamily H member 2Homo sapiens (human)
Golgi membraneMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
basolateral plasma membraneMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase kinase 2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 4Homo sapiens (human)
nucleusSerine/threonine-protein kinase 4Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase 4Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 4Homo sapiens (human)
cytosolSerine/threonine-protein kinase 4Homo sapiens (human)
nuclear bodySerine/threonine-protein kinase 4Homo sapiens (human)
protein-containing complexSerine/threonine-protein kinase 4Homo sapiens (human)
cytoplasm5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
nucleus5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
nucleoplasm5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cytoplasm5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
cytosol5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
apical plasma membrane5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
nuclear speck5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
axon5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
dendrite5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
nucleotide-activated protein kinase complex5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
neuronal cell body5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
chromatin5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
nucleus5'-AMP-activated protein kinase catalytic subunit alpha-1Homo sapiens (human)
spindleDual specificity mitogen-activated protein kinase kinase 5Homo sapiens (human)
nucleusMitogen-activated protein kinase 7Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 7Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 7Homo sapiens (human)
cytosolMitogen-activated protein kinase 7Homo sapiens (human)
PML bodyMitogen-activated protein kinase 7Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 7Homo sapiens (human)
nucleusMitogen-activated protein kinase 7Homo sapiens (human)
nucleusSerine/threonine-protein kinase PAK 2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase PAK 2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase PAK 2Homo sapiens (human)
cytosolSerine/threonine-protein kinase PAK 2Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase PAK 2Homo sapiens (human)
cell-cell junctionSerine/threonine-protein kinase PAK 2Homo sapiens (human)
postsynaptic densitySerine/threonine-protein kinase PAK 2Homo sapiens (human)
secretory granuleSerine/threonine-protein kinase PAK 2Homo sapiens (human)
perinuclear region of cytoplasmSerine/threonine-protein kinase PAK 2Homo sapiens (human)
glutamatergic synapseSerine/threonine-protein kinase PAK 2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 3Homo sapiens (human)
centrosomeSerine/threonine-protein kinase 3Homo sapiens (human)
nucleusSerine/threonine-protein kinase 3Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 3Homo sapiens (human)
cytosolSerine/threonine-protein kinase 3Homo sapiens (human)
protein-containing complexSerine/threonine-protein kinase 3Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 1Homo sapiens (human)
cytosolIntegrin-linked protein kinaseHomo sapiens (human)
plasma membraneIntegrin-linked protein kinaseHomo sapiens (human)
focal adhesionIntegrin-linked protein kinaseHomo sapiens (human)
membraneIntegrin-linked protein kinaseHomo sapiens (human)
sarcomereIntegrin-linked protein kinaseHomo sapiens (human)
lamellipodiumIntegrin-linked protein kinaseHomo sapiens (human)
focal adhesionIntegrin-linked protein kinaseHomo sapiens (human)
stress fiberIntegrin-linked protein kinaseHomo sapiens (human)
Golgi membraneRho-associated protein kinase 1Homo sapiens (human)
ruffleRho-associated protein kinase 1Homo sapiens (human)
extracellular regionRho-associated protein kinase 1Homo sapiens (human)
centrioleRho-associated protein kinase 1Homo sapiens (human)
cytosolRho-associated protein kinase 1Homo sapiens (human)
cytoskeletonRho-associated protein kinase 1Homo sapiens (human)
plasma membraneRho-associated protein kinase 1Homo sapiens (human)
cytoplasmic stress granuleRho-associated protein kinase 1Homo sapiens (human)
lamellipodiumRho-associated protein kinase 1Homo sapiens (human)
blebRho-associated protein kinase 1Homo sapiens (human)
secretory granule lumenRho-associated protein kinase 1Homo sapiens (human)
Schaffer collateral - CA1 synapseRho-associated protein kinase 1Homo sapiens (human)
cytoskeletonRho-associated protein kinase 1Homo sapiens (human)
cytoplasmRho-associated protein kinase 1Homo sapiens (human)
cytoplasmic stress granuleRho-associated protein kinase 1Homo sapiens (human)
cytoplasmNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
membraneNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
plasma membraneNon-receptor tyrosine-protein kinase TNK1Homo sapiens (human)
chromosome, telomeric regionSerine/threonine-protein kinase ATRHomo sapiens (human)
nuclear envelopeSerine/threonine-protein kinase ATRHomo sapiens (human)
site of DNA damageSerine/threonine-protein kinase ATRHomo sapiens (human)
nucleusSerine/threonine-protein kinase ATRHomo sapiens (human)
nucleoplasmSerine/threonine-protein kinase ATRHomo sapiens (human)
chromosomeSerine/threonine-protein kinase ATRHomo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase ATRHomo sapiens (human)
PML bodySerine/threonine-protein kinase ATRHomo sapiens (human)
ATR-ATRIP complexSerine/threonine-protein kinase ATRHomo sapiens (human)
nucleusSerine/threonine-protein kinase ATRHomo sapiens (human)
chromosomeSerine/threonine-protein kinase ATRHomo sapiens (human)
nucleoplasmCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
cytosolCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
membraneCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
endocytic vesicle membraneCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
sarcoplasmic reticulum membraneCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
calcium- and calmodulin-dependent protein kinase complexCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
neuron projectionCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
cytoplasmCalcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiens (human)
nucleusCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
nucleoplasmCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
cytoplasmCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
cytosolCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
membraneCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
endocytic vesicle membraneCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
sarcoplasmic reticulum membraneCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
sarcolemmaCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
calcium- and calmodulin-dependent protein kinase complexCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
cytoplasmCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
neuron projectionCalcium/calmodulin-dependent protein kinase type II subunit deltaHomo sapiens (human)
cytoskeletonDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
nucleusDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
nucleusDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
nucleoplasmDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
cytoplasmDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
nuclear speckDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
axonDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
dendriteDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
ribonucleoprotein complexDual specificity tyrosine-phosphorylation-regulated kinase 1AHomo sapiens (human)
cytoplasmActivin receptor type-2BHomo sapiens (human)
plasma membraneActivin receptor type-2BHomo sapiens (human)
protein-containing complexActivin receptor type-2BHomo sapiens (human)
receptor complexActivin receptor type-2BHomo sapiens (human)
activin receptor complexActivin receptor type-2BHomo sapiens (human)
plasma membraneActivin receptor type-2BHomo sapiens (human)
caveolaBone morphogenetic protein receptor type-2Homo sapiens (human)
extracellular spaceBone morphogenetic protein receptor type-2Homo sapiens (human)
nucleoplasmBone morphogenetic protein receptor type-2Homo sapiens (human)
plasma membraneBone morphogenetic protein receptor type-2Homo sapiens (human)
clathrin-coated pitBone morphogenetic protein receptor type-2Homo sapiens (human)
adherens junctionBone morphogenetic protein receptor type-2Homo sapiens (human)
basal plasma membraneBone morphogenetic protein receptor type-2Homo sapiens (human)
cell surfaceBone morphogenetic protein receptor type-2Homo sapiens (human)
postsynaptic densityBone morphogenetic protein receptor type-2Homo sapiens (human)
apical plasma membraneBone morphogenetic protein receptor type-2Homo sapiens (human)
axonBone morphogenetic protein receptor type-2Homo sapiens (human)
dendriteBone morphogenetic protein receptor type-2Homo sapiens (human)
neuronal cell bodyBone morphogenetic protein receptor type-2Homo sapiens (human)
plasma membraneBone morphogenetic protein receptor type-2Homo sapiens (human)
receptor complexBone morphogenetic protein receptor type-2Homo sapiens (human)
ruffleProtein-tyrosine kinase 6Homo sapiens (human)
nucleusProtein-tyrosine kinase 6Homo sapiens (human)
nucleoplasmProtein-tyrosine kinase 6Homo sapiens (human)
cytoplasmProtein-tyrosine kinase 6Homo sapiens (human)
cytosolProtein-tyrosine kinase 6Homo sapiens (human)
plasma membraneProtein-tyrosine kinase 6Homo sapiens (human)
nuclear bodyProtein-tyrosine kinase 6Homo sapiens (human)
plasma membraneProtein-tyrosine kinase 6Homo sapiens (human)
acrosomal vesiclecGMP-dependent protein kinase 1 Homo sapiens (human)
nucleoplasmcGMP-dependent protein kinase 1 Homo sapiens (human)
cytoplasmcGMP-dependent protein kinase 1 Homo sapiens (human)
Golgi apparatuscGMP-dependent protein kinase 1 Homo sapiens (human)
cytosolcGMP-dependent protein kinase 1 Homo sapiens (human)
plasma membranecGMP-dependent protein kinase 1 Homo sapiens (human)
sarcolemmacGMP-dependent protein kinase 1 Homo sapiens (human)
cyclin K-CDK13 complexCyclin-dependent kinase 13Homo sapiens (human)
extracellular regionCyclin-dependent kinase 13Homo sapiens (human)
extracellular spaceCyclin-dependent kinase 13Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 13Homo sapiens (human)
Golgi apparatusCyclin-dependent kinase 13Homo sapiens (human)
cytosolCyclin-dependent kinase 13Homo sapiens (human)
nuclear speckCyclin-dependent kinase 13Homo sapiens (human)
ficolin-1-rich granule lumenCyclin-dependent kinase 13Homo sapiens (human)
nuclear cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 13Homo sapiens (human)
nucleusCyclin-dependent kinase 13Homo sapiens (human)
cyclin/CDK positive transcription elongation factor complexCyclin-dependent kinase 13Homo sapiens (human)
cytoplasmInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
nucleusInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
nucleoplasmInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
cytoplasmInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
cytosolInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
PML bodyInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
mitochondrial membraneInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
serine/threonine protein kinase complexInhibitor of nuclear factor kappa-B kinase subunit epsilonHomo sapiens (human)
NMDA selective glutamate receptor complexProtein-tyrosine kinase 2-betaHomo sapiens (human)
nucleusProtein-tyrosine kinase 2-betaHomo sapiens (human)
cytoplasmProtein-tyrosine kinase 2-betaHomo sapiens (human)
cytosolProtein-tyrosine kinase 2-betaHomo sapiens (human)
cytoskeletonProtein-tyrosine kinase 2-betaHomo sapiens (human)
focal adhesionProtein-tyrosine kinase 2-betaHomo sapiens (human)
cell cortexProtein-tyrosine kinase 2-betaHomo sapiens (human)
postsynaptic densityProtein-tyrosine kinase 2-betaHomo sapiens (human)
lamellipodiumProtein-tyrosine kinase 2-betaHomo sapiens (human)
dendriteProtein-tyrosine kinase 2-betaHomo sapiens (human)
growth coneProtein-tyrosine kinase 2-betaHomo sapiens (human)
neuronal cell bodyProtein-tyrosine kinase 2-betaHomo sapiens (human)
cell bodyProtein-tyrosine kinase 2-betaHomo sapiens (human)
perinuclear region of cytoplasmProtein-tyrosine kinase 2-betaHomo sapiens (human)
apical dendriteProtein-tyrosine kinase 2-betaHomo sapiens (human)
Schaffer collateral - CA1 synapseProtein-tyrosine kinase 2-betaHomo sapiens (human)
presynapseProtein-tyrosine kinase 2-betaHomo sapiens (human)
glutamatergic synapseProtein-tyrosine kinase 2-betaHomo sapiens (human)
postsynaptic density, intracellular componentProtein-tyrosine kinase 2-betaHomo sapiens (human)
dendritic spineProtein-tyrosine kinase 2-betaHomo sapiens (human)
focal adhesionProtein-tyrosine kinase 2-betaHomo sapiens (human)
plasma membraneProtein-tyrosine kinase 2-betaHomo sapiens (human)
plasma membraneMaternal embryonic leucine zipper kinaseHomo sapiens (human)
cell cortexMaternal embryonic leucine zipper kinaseHomo sapiens (human)
membraneMaternal embryonic leucine zipper kinaseHomo sapiens (human)
cytoplasmMaternal embryonic leucine zipper kinaseHomo sapiens (human)
chromosome, centromeric regionStructural maintenance of chromosomes protein 1AHomo sapiens (human)
kinetochoreStructural maintenance of chromosomes protein 1AHomo sapiens (human)
condensed nuclear chromosomeStructural maintenance of chromosomes protein 1AHomo sapiens (human)
nucleusStructural maintenance of chromosomes protein 1AHomo sapiens (human)
nucleoplasmStructural maintenance of chromosomes protein 1AHomo sapiens (human)
chromosomeStructural maintenance of chromosomes protein 1AHomo sapiens (human)
cytosolStructural maintenance of chromosomes protein 1AHomo sapiens (human)
nuclear matrixStructural maintenance of chromosomes protein 1AHomo sapiens (human)
mitotic cohesin complexStructural maintenance of chromosomes protein 1AHomo sapiens (human)
meiotic cohesin complexStructural maintenance of chromosomes protein 1AHomo sapiens (human)
mitotic spindle poleStructural maintenance of chromosomes protein 1AHomo sapiens (human)
cohesin complexStructural maintenance of chromosomes protein 1AHomo sapiens (human)
nucleusStructural maintenance of chromosomes protein 1AHomo sapiens (human)
chromosome, telomeric regionChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
nucleusChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
nucleoplasmChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
cytoplasmChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
centrosomeChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
membraneChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
NuRD complexChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
site of DNA damageChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
cerebellar granule cell to Purkinje cell synapseChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
chromatinChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
protein-containing complexChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
RNA polymerase II transcription regulator complexChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
nucleusChromodomain-helicase-DNA-binding protein 4Homo sapiens (human)
peroxisomePeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
peroxisomePeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
peroxisomal membranePeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
peroxisomal matrixPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
cytosolPeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
membranePeroxisomal acyl-coenzyme A oxidase 1Homo sapiens (human)
plasma membraneEphrin type-A receptor 7Homo sapiens (human)
glutamatergic synapseEphrin type-A receptor 7Homo sapiens (human)
plasma membraneEphrin type-A receptor 7Homo sapiens (human)
dendriteEphrin type-A receptor 7Homo sapiens (human)
Golgi membraneDelta(24)-sterol reductaseHomo sapiens (human)
nucleusDelta(24)-sterol reductaseHomo sapiens (human)
endoplasmic reticulumDelta(24)-sterol reductaseHomo sapiens (human)
endoplasmic reticulum membraneDelta(24)-sterol reductaseHomo sapiens (human)
membraneDelta(24)-sterol reductaseHomo sapiens (human)
cytoplasmDelta(24)-sterol reductaseHomo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-1Homo sapiens (human)
cytosolRibosomal protein S6 kinase alpha-1Homo sapiens (human)
synapseRibosomal protein S6 kinase alpha-1Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-1Homo sapiens (human)
cytoplasmRibosomal protein S6 kinase alpha-1Homo sapiens (human)
cytoplasmic vesicleDual specificity testis-specific protein kinase 1Homo sapiens (human)
cytoplasmDual specificity testis-specific protein kinase 1Homo sapiens (human)
centrosomeDual specificity testis-specific protein kinase 1Homo sapiens (human)
cytosolDual specificity testis-specific protein kinase 1Homo sapiens (human)
lamellipodiumDual specificity testis-specific protein kinase 1Homo sapiens (human)
perinuclear region of cytoplasmDual specificity testis-specific protein kinase 1Homo sapiens (human)
cytoplasmDual specificity testis-specific protein kinase 1Homo sapiens (human)
nucleusDual specificity testis-specific protein kinase 1Homo sapiens (human)
stress fiberMyosin light chain kinase, smooth muscleHomo sapiens (human)
cytoplasmMyosin light chain kinase, smooth muscleHomo sapiens (human)
cytosolMyosin light chain kinase, smooth muscleHomo sapiens (human)
plasma membraneMyosin light chain kinase, smooth muscleHomo sapiens (human)
actin cytoskeletonMyosin light chain kinase, smooth muscleHomo sapiens (human)
lamellipodiumMyosin light chain kinase, smooth muscleHomo sapiens (human)
cleavage furrowMyosin light chain kinase, smooth muscleHomo sapiens (human)
cleavage furrowMyosin light chain kinase, smooth muscleHomo sapiens (human)
stress fiberMyosin light chain kinase, smooth muscleHomo sapiens (human)
lamellipodiumMyosin light chain kinase, smooth muscleHomo sapiens (human)
cytoplasmMyosin light chain kinase, smooth muscleHomo sapiens (human)
nucleoplasmMitogen-activated protein kinase 11Homo sapiens (human)
cytosolMitogen-activated protein kinase 11Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 11Homo sapiens (human)
nucleusMitogen-activated protein kinase 11Homo sapiens (human)
nucleusSerine/threonine-protein kinase STK11Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase STK11Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase STK11Homo sapiens (human)
mitochondrionSerine/threonine-protein kinase STK11Homo sapiens (human)
cytosolSerine/threonine-protein kinase STK11Homo sapiens (human)
membraneSerine/threonine-protein kinase STK11Homo sapiens (human)
Z discSerine/threonine-protein kinase STK11Homo sapiens (human)
extracellular exosomeSerine/threonine-protein kinase STK11Homo sapiens (human)
serine/threonine protein kinase complexSerine/threonine-protein kinase STK11Homo sapiens (human)
intracellular protein-containing complexSerine/threonine-protein kinase STK11Homo sapiens (human)
nucleusSerine/threonine-protein kinase STK11Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase STK11Homo sapiens (human)
nucleusSerine/threonine-protein kinase N1Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase N1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase N1Homo sapiens (human)
endosomeSerine/threonine-protein kinase N1Homo sapiens (human)
cytosolSerine/threonine-protein kinase N1Homo sapiens (human)
midbodySerine/threonine-protein kinase N1Homo sapiens (human)
cleavage furrowSerine/threonine-protein kinase N1Homo sapiens (human)
protein-containing complexSerine/threonine-protein kinase N1Homo sapiens (human)
nucleusSerine/threonine-protein kinase N2Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase N2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase N2Homo sapiens (human)
centrosomeSerine/threonine-protein kinase N2Homo sapiens (human)
cytosolSerine/threonine-protein kinase N2Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase N2Homo sapiens (human)
nuclear bodySerine/threonine-protein kinase N2Homo sapiens (human)
lamellipodiumSerine/threonine-protein kinase N2Homo sapiens (human)
midbodySerine/threonine-protein kinase N2Homo sapiens (human)
cleavage furrowSerine/threonine-protein kinase N2Homo sapiens (human)
apical junction complexSerine/threonine-protein kinase N2Homo sapiens (human)
intermediate filament cytoskeletonSerine/threonine-protein kinase N2Homo sapiens (human)
perinuclear region of cytoplasmSerine/threonine-protein kinase N2Homo sapiens (human)
protein-containing complexSerine/threonine-protein kinase N2Homo sapiens (human)
cytosolMitogen-activated protein kinase 14Homo sapiens (human)
spindle poleMitogen-activated protein kinase 14Homo sapiens (human)
extracellular regionMitogen-activated protein kinase 14Homo sapiens (human)
nucleusMitogen-activated protein kinase 14Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 14Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 14Homo sapiens (human)
mitochondrionMitogen-activated protein kinase 14Homo sapiens (human)
cytosolMitogen-activated protein kinase 14Homo sapiens (human)
nuclear speckMitogen-activated protein kinase 14Homo sapiens (human)
secretory granule lumenMitogen-activated protein kinase 14Homo sapiens (human)
glutamatergic synapseMitogen-activated protein kinase 14Homo sapiens (human)
ficolin-1-rich granule lumenMitogen-activated protein kinase 14Homo sapiens (human)
nucleusMitogen-activated protein kinase 14Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 14Homo sapiens (human)
fibrillar centerCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
nucleoplasmCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
extracellular exosomeCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
cytoplasmCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
nucleusCalcium/calmodulin-dependent protein kinase type IVHomo sapiens (human)
centrosomeMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
microtubuleMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
membraneMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
centrosomeMitogen-activated protein kinase kinase kinase 11Homo sapiens (human)
plasma membraneDiscoidin domain-containing receptor 2Homo sapiens (human)
focal adhesionDiscoidin domain-containing receptor 2Homo sapiens (human)
actin cytoskeletonDiscoidin domain-containing receptor 2Homo sapiens (human)
apical plasma membraneDiscoidin domain-containing receptor 2Homo sapiens (human)
receptor complexDiscoidin domain-containing receptor 2Homo sapiens (human)
plasma membraneDiscoidin domain-containing receptor 2Homo sapiens (human)
cytosolAP2-associated protein kinase 1Homo sapiens (human)
plasma membraneAP2-associated protein kinase 1Homo sapiens (human)
clathrin-coated pitAP2-associated protein kinase 1Homo sapiens (human)
clathrin-coated vesicleAP2-associated protein kinase 1Homo sapiens (human)
cell leading edgeAP2-associated protein kinase 1Homo sapiens (human)
terminal boutonAP2-associated protein kinase 1Homo sapiens (human)
intracellular membrane-bounded organelleAP2-associated protein kinase 1Homo sapiens (human)
presynapseAP2-associated protein kinase 1Homo sapiens (human)
cytoplasmMyosin light chain kinase 3Homo sapiens (human)
cytosolMyosin light chain kinase 3Homo sapiens (human)
cytoplasmMyosin light chain kinase 3Homo sapiens (human)
actin cytoskeletonMyosin light chain kinase 3Homo sapiens (human)
membraneUncharacterized aarF domain-containing protein kinase 5Homo sapiens (human)
extracellular exosomePutative heat shock protein HSP 90-beta 2Homo sapiens (human)
perinuclear region of cytoplasmPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
protein-containing complexPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
plasma membranePutative heat shock protein HSP 90-beta 2Homo sapiens (human)
cytosolPutative heat shock protein HSP 90-beta 2Homo sapiens (human)
endomembrane systemRab-like protein 3Homo sapiens (human)
cytosolSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
cell-cell junctionSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
lamellipodiumSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
cell leading edgeSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
actomyosinSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
extracellular exosomeSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
actomyosinSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
cytoskeletonSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase MRCK alphaHomo sapiens (human)
cytosolSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
cell leading edgeSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
centriolar satelliteSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
cytoskeletonSerine/threonine-protein kinase MRCK gammaHomo sapiens (human)
mitochondrionAcyl-CoA dehydrogenase family member 10Homo sapiens (human)
mitochondrial matrixAcyl-CoA dehydrogenase family member 10Homo sapiens (human)
cytoplasmAcyl-CoA dehydrogenase family member 10Homo sapiens (human)
phagophore assembly siteSerine/threonine-protein kinase ULK3Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase ULK3Homo sapiens (human)
ciliary tipSerine/threonine-protein kinase ULK3Homo sapiens (human)
phagophore assembly site membraneSerine/threonine-protein kinase ULK3Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase ULK3Homo sapiens (human)
cytosolSerine/threonine-protein kinase ULK3Homo sapiens (human)
autophagosomeSerine/threonine-protein kinase ULK3Homo sapiens (human)
phagophore assembly siteSerine/threonine-protein kinase ULK3Homo sapiens (human)
nucleusAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
mitochondrial inner membraneAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
peroxisomeAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
mitochondrial membraneAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
mitochondrionAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
cytoplasmAcyl-CoA dehydrogenase family member 11Homo sapiens (human)
endoplasmic reticulumSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
cytosolSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
endoplasmic reticulum quality control compartmentSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
IRE1-TRAF2-ASK1 complexSerine/threonine-protein kinase/endoribonuclease IRE2Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase MARK2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase MARK2Homo sapiens (human)
mitochondrionSerine/threonine-protein kinase MARK2Homo sapiens (human)
actin filamentSerine/threonine-protein kinase MARK2Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase MARK2Homo sapiens (human)
membraneSerine/threonine-protein kinase MARK2Homo sapiens (human)
lateral plasma membraneSerine/threonine-protein kinase MARK2Homo sapiens (human)
dendriteSerine/threonine-protein kinase MARK2Homo sapiens (human)
microtubule bundleSerine/threonine-protein kinase MARK2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase MARK2Homo sapiens (human)
cytoplasmATP-dependent RNA helicase DHX30Homo sapiens (human)
mitochondrionATP-dependent RNA helicase DHX30Homo sapiens (human)
cytosolATP-dependent RNA helicase DHX30Homo sapiens (human)
ribonucleoprotein granuleATP-dependent RNA helicase DHX30Homo sapiens (human)
mitochondrial nucleoidATP-dependent RNA helicase DHX30Homo sapiens (human)
cytoplasmATP-dependent RNA helicase DHX30Homo sapiens (human)
nucleusATP-dependent RNA helicase DHX30Homo sapiens (human)
intracellular anatomical structureATP-dependent RNA helicase DHX30Homo sapiens (human)
cytosolSerine/threonine-protein kinase TAO1Homo sapiens (human)
microtubule cytoskeletonSerine/threonine-protein kinase TAO1Homo sapiens (human)
perinuclear region of cytoplasmSerine/threonine-protein kinase TAO1Homo sapiens (human)
extracellular exosomeSerine/threonine-protein kinase TAO1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase TAO1Homo sapiens (human)
nucleusSTE20-related kinase adapter protein alphaHomo sapiens (human)
nucleoplasmSTE20-related kinase adapter protein alphaHomo sapiens (human)
cytoplasmSTE20-related kinase adapter protein alphaHomo sapiens (human)
cytosolSTE20-related kinase adapter protein alphaHomo sapiens (human)
serine/threonine protein kinase complexSTE20-related kinase adapter protein alphaHomo sapiens (human)
intracellular protein-containing complexSTE20-related kinase adapter protein alphaHomo sapiens (human)
stress fiberMyosin-14Homo sapiens (human)
cytosolMyosin-14Homo sapiens (human)
brush borderMyosin-14Homo sapiens (human)
membraneMyosin-14Homo sapiens (human)
growth coneMyosin-14Homo sapiens (human)
actomyosinMyosin-14Homo sapiens (human)
extracellular exosomeMyosin-14Homo sapiens (human)
myosin II filamentMyosin-14Homo sapiens (human)
myosin II complexMyosin-14Homo sapiens (human)
cytoplasmMyosin-14Homo sapiens (human)
myosin filamentMyosin-14Homo sapiens (human)
mitochondrionAarF domain-containing protein kinase 1Homo sapiens (human)
mitochondrial inner membraneAarF domain-containing protein kinase 1Homo sapiens (human)
nucleusATP-dependent RNA helicase DDX42Homo sapiens (human)
nucleoplasmATP-dependent RNA helicase DDX42Homo sapiens (human)
cytoplasmATP-dependent RNA helicase DDX42Homo sapiens (human)
cytosolATP-dependent RNA helicase DDX42Homo sapiens (human)
Cajal bodyATP-dependent RNA helicase DDX42Homo sapiens (human)
membraneATP-dependent RNA helicase DDX42Homo sapiens (human)
nuclear speckATP-dependent RNA helicase DDX42Homo sapiens (human)
U2-type prespliceosomeATP-dependent RNA helicase DDX42Homo sapiens (human)
nucleusATP-dependent RNA helicase DDX42Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase kinase 3Homo sapiens (human)
nucleoplasmMAP kinase-activated protein kinase 5Homo sapiens (human)
cytosolMAP kinase-activated protein kinase 5Homo sapiens (human)
septin cytoskeletonMAP kinase-activated protein kinase 5Homo sapiens (human)
protein-containing complexMAP kinase-activated protein kinase 5Homo sapiens (human)
cytoplasmMAP kinase-activated protein kinase 5Homo sapiens (human)
nucleusMAP kinase-activated protein kinase 5Homo sapiens (human)
cytoplasmMisshapen-like kinase 1Homo sapiens (human)
Golgi apparatusMisshapen-like kinase 1Homo sapiens (human)
cytosolMisshapen-like kinase 1Homo sapiens (human)
postsynaptic densityMisshapen-like kinase 1Homo sapiens (human)
axonMisshapen-like kinase 1Homo sapiens (human)
dendriteMisshapen-like kinase 1Homo sapiens (human)
extracellular exosomeMisshapen-like kinase 1Homo sapiens (human)
cytoplasmMisshapen-like kinase 1Homo sapiens (human)
mitochondrionAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
membraneAtypical kinase COQ8A, mitochondrialHomo sapiens (human)
nucleoplasmPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
autophagosomePhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
endoplasmic reticulumPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
cytosolPhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
plasma membranePhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
intracellular organellePhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
extracellular exosomePhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
plasma membranePhosphatidylinositol 5-phosphate 4-kinase type-2 gammaHomo sapiens (human)
axonemeMitogen-activated protein kinase 15Homo sapiens (human)
extracellular regionMitogen-activated protein kinase 15Homo sapiens (human)
nucleusMitogen-activated protein kinase 15Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 15Homo sapiens (human)
autophagosomeMitogen-activated protein kinase 15Homo sapiens (human)
Golgi apparatusMitogen-activated protein kinase 15Homo sapiens (human)
centrioleMitogen-activated protein kinase 15Homo sapiens (human)
cell-cell junctionMitogen-activated protein kinase 15Homo sapiens (human)
bicellular tight junctionMitogen-activated protein kinase 15Homo sapiens (human)
cytoplasmic vesicleMitogen-activated protein kinase 15Homo sapiens (human)
ciliary basal bodyMitogen-activated protein kinase 15Homo sapiens (human)
meiotic spindleMitogen-activated protein kinase 15Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 15Homo sapiens (human)
nucleusMitogen-activated protein kinase 15Homo sapiens (human)
centrosomeSerine/threonine-protein kinase Nek9Homo sapiens (human)
nucleusSerine/threonine-protein kinase Nek9Homo sapiens (human)
cytosolSerine/threonine-protein kinase Nek9Homo sapiens (human)
microtubule organizing centerSerine/threonine-protein kinase Nek7Homo sapiens (human)
spindle poleSerine/threonine-protein kinase Nek7Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase Nek7Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase Nek7Homo sapiens (human)
centrosomeSerine/threonine-protein kinase Nek7Homo sapiens (human)
microtubuleSerine/threonine-protein kinase Nek7Homo sapiens (human)
nucleusSerine/threonine-protein kinase Nek7Homo sapiens (human)
nucleusATP-dependent RNA helicase DDX1Homo sapiens (human)
nucleoplasmATP-dependent RNA helicase DDX1Homo sapiens (human)
cytoplasmATP-dependent RNA helicase DDX1Homo sapiens (human)
mitochondrionATP-dependent RNA helicase DDX1Homo sapiens (human)
cytosolATP-dependent RNA helicase DDX1Homo sapiens (human)
cytoplasmic stress granuleATP-dependent RNA helicase DDX1Homo sapiens (human)
membraneATP-dependent RNA helicase DDX1Homo sapiens (human)
cleavage bodyATP-dependent RNA helicase DDX1Homo sapiens (human)
tRNA-splicing ligase complexATP-dependent RNA helicase DDX1Homo sapiens (human)
ribonucleoprotein complexATP-dependent RNA helicase DDX1Homo sapiens (human)
membraneMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase kinase 1Homo sapiens (human)
kinetochoreAurora kinase BHomo sapiens (human)
condensed chromosome, centromeric regionAurora kinase BHomo sapiens (human)
nucleusAurora kinase BHomo sapiens (human)
nucleoplasmAurora kinase BHomo sapiens (human)
spindleAurora kinase BHomo sapiens (human)
cytosolAurora kinase BHomo sapiens (human)
chromocenterAurora kinase BHomo sapiens (human)
microtubule cytoskeletonAurora kinase BHomo sapiens (human)
midbodyAurora kinase BHomo sapiens (human)
chromosome passenger complexAurora kinase BHomo sapiens (human)
mitotic spindle poleAurora kinase BHomo sapiens (human)
mitotic spindle midzoneAurora kinase BHomo sapiens (human)
kinetochoreAurora kinase BHomo sapiens (human)
spindle pole centrosomeAurora kinase BHomo sapiens (human)
spindle microtubuleAurora kinase BHomo sapiens (human)
spindle midzoneAurora kinase BHomo sapiens (human)
microtubule organizing centerMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
cytoplasmMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
centrosomeMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
microtubule organizing centerMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
cytosolMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
microtubule cytoskeletonMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
dendriteMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
midbodyMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
neuron projectionMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
gamma-tubulin complexMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
ciliary basal bodyMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
cytoplasmMAP/microtubule affinity-regulating kinase 4Homo sapiens (human)
pericentriolar materialSerine/threonine-protein kinase Nek1Homo sapiens (human)
nucleusSerine/threonine-protein kinase Nek1Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase Nek1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase Nek1Homo sapiens (human)
centrosomeSerine/threonine-protein kinase Nek1Homo sapiens (human)
cytosolSerine/threonine-protein kinase Nek1Homo sapiens (human)
centriolar satelliteSerine/threonine-protein kinase Nek1Homo sapiens (human)
nucleoplasmCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
cytosolCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
neuron projectionCalcium/calmodulin-dependent protein kinase kinase 2Homo sapiens (human)
nucleusEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
nucleoplasmEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
cytoplasmEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
EKC/KEOPS complexEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
cytosolEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
nucleusEKC/KEOPS complex subunit TP53RKHomo sapiens (human)
Golgi membraneMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
nucleoplasmMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
nucleolusMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
endoplasmic reticulumMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
endoplasmic reticulum membraneMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
Golgi apparatusMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
cytosolMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
membraneMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
cytoplasmMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
nucleusMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinaseHomo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
external side of plasma membraneMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein-containing complexMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein kinase complexMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
IRE1-TRAF2-ASK1 complexMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 3Homo sapiens (human)
cytosolEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
cytosolEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
nucleusEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
cytoplasmEukaryotic translation initiation factor 2-alpha kinase 1Homo sapiens (human)
nucleusNucleolar GTP-binding protein 1Homo sapiens (human)
nucleoplasmNucleolar GTP-binding protein 1Homo sapiens (human)
nucleolusNucleolar GTP-binding protein 1Homo sapiens (human)
cytoplasmNucleolar GTP-binding protein 1Homo sapiens (human)
cytosolNucleolar GTP-binding protein 1Homo sapiens (human)
membraneNucleolar GTP-binding protein 1Homo sapiens (human)
nuclear membraneNucleolar GTP-binding protein 1Homo sapiens (human)
perinuclear region of cytoplasmNucleolar GTP-binding protein 1Homo sapiens (human)
nucleolusNucleolar GTP-binding protein 1Homo sapiens (human)
nucleusSerine/threonine-protein kinase D2Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase D2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase D2Homo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase D2Homo sapiens (human)
cytosolSerine/threonine-protein kinase D2Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase D2Homo sapiens (human)
cytosolSerine/threonine-protein kinase D2Homo sapiens (human)
chromosome, telomeric regionRNA cytidine acetyltransferaseHomo sapiens (human)
nucleusRNA cytidine acetyltransferaseHomo sapiens (human)
nucleoplasmRNA cytidine acetyltransferaseHomo sapiens (human)
nucleolusRNA cytidine acetyltransferaseHomo sapiens (human)
membraneRNA cytidine acetyltransferaseHomo sapiens (human)
midbodyRNA cytidine acetyltransferaseHomo sapiens (human)
telomerase holoenzyme complexRNA cytidine acetyltransferaseHomo sapiens (human)
small-subunit processomeRNA cytidine acetyltransferaseHomo sapiens (human)
nucleolusRNA cytidine acetyltransferaseHomo sapiens (human)
endoplasmic reticulum membraneSerine/threonine-protein kinase SIK2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase SIK2Homo sapiens (human)
nucleusSerine/threonine-protein kinase SIK2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase SIK2Homo sapiens (human)
cytoplasmSTE20-like serine/threonine-protein kinase Homo sapiens (human)
cytosolSTE20-like serine/threonine-protein kinase Homo sapiens (human)
cell leading edgeSTE20-like serine/threonine-protein kinase Homo sapiens (human)
perinuclear region of cytoplasmSTE20-like serine/threonine-protein kinase Homo sapiens (human)
extracellular exosomeSTE20-like serine/threonine-protein kinase Homo sapiens (human)
cytoplasmSTE20-like serine/threonine-protein kinase Homo sapiens (human)
plasma membraneSerine/threonine-protein kinase TAO3Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase TAO3Homo sapiens (human)
nucleusdCTP pyrophosphatase 1Homo sapiens (human)
nucleoplasmdCTP pyrophosphatase 1Homo sapiens (human)
mitochondriondCTP pyrophosphatase 1Homo sapiens (human)
cytosoldCTP pyrophosphatase 1Homo sapiens (human)
cytosoldCTP pyrophosphatase 1Homo sapiens (human)
nucleusDual specificity protein kinase CLK4Homo sapiens (human)
cytosolCasein kinase I isoform gamma-1Homo sapiens (human)
nucleusCasein kinase I isoform gamma-1Homo sapiens (human)
plasma membraneCasein kinase I isoform gamma-1Homo sapiens (human)
cytoplasmCasein kinase I isoform gamma-1Homo sapiens (human)
fibrillar centerSerine/threonine-protein kinase PAK 6Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase PAK 6Homo sapiens (human)
cytosolSerine/threonine-protein kinase PAK 6Homo sapiens (human)
postsynaptic densitySerine/threonine-protein kinase PAK 6Homo sapiens (human)
cell junctionSerine/threonine-protein kinase PAK 6Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase PAK 6Homo sapiens (human)
cytoplasmPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
cytosolPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
phenylalanine-tRNA ligase complexPhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
membranePhenylalanine--tRNA ligase beta subunitHomo sapiens (human)
mitochondrial matrixIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
mitochondrionIsoleucine--tRNA ligase, mitochondrialHomo sapiens (human)
nuclear speckBMP-2-inducible protein kinaseHomo sapiens (human)
cytoplasmBMP-2-inducible protein kinaseHomo sapiens (human)
nucleusBMP-2-inducible protein kinaseHomo sapiens (human)
extracellular regionObg-like ATPase 1Homo sapiens (human)
nucleolusObg-like ATPase 1Homo sapiens (human)
cytoplasmObg-like ATPase 1Homo sapiens (human)
centrosomeObg-like ATPase 1Homo sapiens (human)
cytosolObg-like ATPase 1Homo sapiens (human)
membraneObg-like ATPase 1Homo sapiens (human)
platelet alpha granule lumenObg-like ATPase 1Homo sapiens (human)
extracellular exosomeObg-like ATPase 1Homo sapiens (human)
cytoplasmObg-like ATPase 1Homo sapiens (human)
nucleusMidasinHomo sapiens (human)
nucleoplasmMidasinHomo sapiens (human)
nucleolusMidasinHomo sapiens (human)
cytosolMidasinHomo sapiens (human)
membraneMidasinHomo sapiens (human)
intermediate filament cytoskeletonMidasinHomo sapiens (human)
nucleusMidasinHomo sapiens (human)
preribosome, large subunit precursorMidasinHomo sapiens (human)
cytoplasmInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
cell surfaceInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
extrinsic component of plasma membraneInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
extracellular spaceInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
cytosolInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
plasma membraneInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
endosome membraneInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
nucleusInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
plasma membraneInterleukin-1 receptor-associated kinase 4Homo sapiens (human)
nucleusMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 20Homo sapiens (human)
cyclin K-CDK12 complexCyclin-dependent kinase 12Homo sapiens (human)
nucleoplasmCyclin-dependent kinase 12Homo sapiens (human)
nuclear speckCyclin-dependent kinase 12Homo sapiens (human)
nuclear cyclin-dependent protein kinase holoenzyme complexCyclin-dependent kinase 12Homo sapiens (human)
nucleusCyclin-dependent kinase 12Homo sapiens (human)
cyclin/CDK positive transcription elongation factor complexCyclin-dependent kinase 12Homo sapiens (human)
nucleoplasmNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
cytoplasmNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
mitochondrionNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
mitochondrial inner membraneNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
mitochondrial respirasomeNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
mitochondrial respiratory chain complex INADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
mitochondrial membraneNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase pim-2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 26Homo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase 26Homo sapiens (human)
Golgi-associated vesicleSerine/threonine-protein kinase 26Homo sapiens (human)
cytosolSerine/threonine-protein kinase 26Homo sapiens (human)
vesicle membraneSerine/threonine-protein kinase 26Homo sapiens (human)
membraneSerine/threonine-protein kinase 26Homo sapiens (human)
apical plasma membraneSerine/threonine-protein kinase 26Homo sapiens (human)
perinuclear region of cytoplasmSerine/threonine-protein kinase 26Homo sapiens (human)
extracellular exosomeSerine/threonine-protein kinase 26Homo sapiens (human)
cell peripherySerine/threonine-protein kinase 26Homo sapiens (human)
FAR/SIN/STRIPAK complexSerine/threonine-protein kinase 26Homo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase 26Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 26Homo sapiens (human)
mitochondrionSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
mitochondrial matrixSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
succinate-CoA ligase complex (ADP-forming)Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
extracellular exosomeSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
mitochondrionSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
succinate-CoA ligase complexSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialHomo sapiens (human)
nucleusSerine/threonine-protein kinase NLKHomo sapiens (human)
nucleoplasmSerine/threonine-protein kinase NLKHomo sapiens (human)
cytosolSerine/threonine-protein kinase NLKHomo sapiens (human)
nucleusSerine/threonine-protein kinase NLKHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase NLKHomo sapiens (human)
extracellular space5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
nucleoplasm5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
cytosol5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
nucleotide-activated protein kinase complex5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
cytoplasm5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
nucleus5'-AMP-activated protein kinase subunit gamma-2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase TBK1Homo sapiens (human)
cytosolSerine/threonine-protein kinase TBK1Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase TBK1Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase TBK1Homo sapiens (human)
cytosolSerine/threonine-protein kinase TBK1Homo sapiens (human)
intracellular membrane-bounded organelleSerine/threonine-protein kinase TBK1Homo sapiens (human)
serine/threonine protein kinase complexSerine/threonine-protein kinase TBK1Homo sapiens (human)
stress fiberSeptin-9Homo sapiens (human)
cytoplasmSeptin-9Homo sapiens (human)
microtubuleSeptin-9Homo sapiens (human)
axonemeSeptin-9Homo sapiens (human)
actin cytoskeletonSeptin-9Homo sapiens (human)
perinuclear region of cytoplasmSeptin-9Homo sapiens (human)
non-motile ciliumSeptin-9Homo sapiens (human)
septin complexSeptin-9Homo sapiens (human)
septin ringSeptin-9Homo sapiens (human)
microtubule cytoskeletonSeptin-9Homo sapiens (human)
cell division siteSeptin-9Homo sapiens (human)
fibrillar centerRibosomal protein S6 kinase alpha-6Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-6Homo sapiens (human)
nucleolusRibosomal protein S6 kinase alpha-6Homo sapiens (human)
mitochondrionRibosomal protein S6 kinase alpha-6Homo sapiens (human)
cytosolRibosomal protein S6 kinase alpha-6Homo sapiens (human)
cytoplasmRibosomal protein S6 kinase alpha-6Homo sapiens (human)
nucleoplasmRibosomal protein S6 kinase alpha-6Homo sapiens (human)
nucleusTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
nucleoplasmTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
cytoplasmTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
cytosolTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
cytoskeletonTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
apical plasma membraneTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
recycling endosomeTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
extracellular exosomeTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
presynapseTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
glutamatergic synapseTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
postsynaptic density, intracellular componentTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
cytoplasmTRAF2 and NCK-interacting protein kinaseHomo sapiens (human)
actin cytoskeletonSerine/threonine-protein kinase TAO2Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase TAO2Homo sapiens (human)
nucleolusSerine/threonine-protein kinase TAO2Homo sapiens (human)
cytosolSerine/threonine-protein kinase TAO2Homo sapiens (human)
axonSerine/threonine-protein kinase TAO2Homo sapiens (human)
cytoplasmic vesicle membraneSerine/threonine-protein kinase TAO2Homo sapiens (human)
cytoplasmic vesicleSerine/threonine-protein kinase TAO2Homo sapiens (human)
neuron projectionSerine/threonine-protein kinase TAO2Homo sapiens (human)
dendritic growth coneSerine/threonine-protein kinase TAO2Homo sapiens (human)
axonal growth coneSerine/threonine-protein kinase TAO2Homo sapiens (human)
receptor complexSerine/threonine-protein kinase TAO2Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase TAO2Homo sapiens (human)
plasma membraneALK tyrosine kinase receptorHomo sapiens (human)
plasma membraneALK tyrosine kinase receptorHomo sapiens (human)
extracellular exosomeALK tyrosine kinase receptorHomo sapiens (human)
protein-containing complexALK tyrosine kinase receptorHomo sapiens (human)
receptor complexALK tyrosine kinase receptorHomo sapiens (human)
fibrillar centerSerine/threonine-protein kinase ICKHomo sapiens (human)
nucleusSerine/threonine-protein kinase ICKHomo sapiens (human)
cytosolSerine/threonine-protein kinase ICKHomo sapiens (human)
ciliumSerine/threonine-protein kinase ICKHomo sapiens (human)
ciliary basal bodySerine/threonine-protein kinase ICKHomo sapiens (human)
ciliary tipSerine/threonine-protein kinase ICKHomo sapiens (human)
ciliary baseSerine/threonine-protein kinase ICKHomo sapiens (human)
nucleusSerine/threonine-protein kinase ICKHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase ICKHomo sapiens (human)
ciliumSerine/threonine-protein kinase ICKHomo sapiens (human)
nucleusRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
cytoplasmRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
membraneRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
nucleoplasmRAC-gamma serine/threonine-protein kinaseHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase 38-likeHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase 38-likeHomo sapiens (human)
cytosolSerine/threonine-protein kinase 38-likeHomo sapiens (human)
actin cytoskeletonSerine/threonine-protein kinase 38-likeHomo sapiens (human)
membraneSerine/threonine-protein kinase 38-likeHomo sapiens (human)
glutamatergic synapseSerine/threonine-protein kinase 38-likeHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase SIK3Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 2Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
plasma membraneMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase kinase 5Homo sapiens (human)
nucleusReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
nucleusReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
cytosolReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
protein-containing complexReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
cytoplasmReceptor-interacting serine/threonine-protein kinase 3Homo sapiens (human)
cytosolSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
plasma membraneSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
cell-cell junctionSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
lamellipodiumSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
cell leading edgeSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
actomyosinSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
extracellular exosomeSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
cytoskeletonSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
cytoplasmSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
actomyosinSerine/threonine-protein kinase MRCK betaHomo sapiens (human)
nucleusInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
cytoplasmInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
nucleusInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
plasma membraneInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
cytoplasmInterleukin-1 receptor-associated kinase 3Homo sapiens (human)
Golgi membraneSerine/threonine-protein kinase 24Homo sapiens (human)
nucleusSerine/threonine-protein kinase 24Homo sapiens (human)
nucleoplasmSerine/threonine-protein kinase 24Homo sapiens (human)
nucleolusSerine/threonine-protein kinase 24Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 24Homo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase 24Homo sapiens (human)
cytosolSerine/threonine-protein kinase 24Homo sapiens (human)
extracellular exosomeSerine/threonine-protein kinase 24Homo sapiens (human)
FAR/SIN/STRIPAK complexSerine/threonine-protein kinase 24Homo sapiens (human)
Golgi apparatusSerine/threonine-protein kinase 24Homo sapiens (human)
cytoplasmSerine/threonine-protein kinase 24Homo sapiens (human)
cytoplasmCasein kinase I isoform gamma-3Homo sapiens (human)
plasma membraneCasein kinase I isoform gamma-3Homo sapiens (human)
cytoplasmCasein kinase I isoform gamma-3Homo sapiens (human)
nucleusCasein kinase I isoform gamma-3Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
perinuclear region of cytoplasmMitogen-activated protein kinase kinase kinase 4Homo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Bioassays (499)

Assay IDTitleYearJournalArticle
AID1296008Cytotoxic Profiling of Annotated Libraries Using Quantitative High-Throughput Screening2020SLAS discovery : advancing life sciences R & D, 01, Volume: 25, Issue:1
Cytotoxic Profiling of Annotated and Diverse Chemical Libraries Using Quantitative High-Throughput Screening.
AID1347098qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for SK-N-SH cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347108qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Rh41 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347101qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for BT-12 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1346987P-glycoprotein substrates identified in KB-8-5-11 adenocarcinoma cell line, qHTS therapeutic library screen2019Molecular pharmacology, 11, Volume: 96, Issue:5
A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein.
AID1347086qHTS for Inhibitors of the Functional Ribonucleoprotein Complex (vRNP) of Lymphocytic Choriomeningitis Arenaviruses (LCMV): LCMV Primary Screen - GLuc reporter signal2020Antiviral research, 01, Volume: 173A cell-based, infectious-free, platform to identify inhibitors of lassa virus ribonucleoprotein (vRNP) activity.
AID1347083qHTS for Inhibitors of the Functional Ribonucleoprotein Complex (vRNP) of Lassa (LASV) Arenavirus: Viability assay - alamar blue signal for LASV Primary Screen2020Antiviral research, 01, Volume: 173A cell-based, infectious-free, platform to identify inhibitors of lassa virus ribonucleoprotein (vRNP) activity.
AID1347099qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for NB1643 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347154Primary screen GU AMC qHTS for Zika virus inhibitors2020Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors.
AID1347104qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for RD cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347100qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for LAN-5 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1745845Primary qHTS for Inhibitors of ATXN expression
AID1347107qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Rh30 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347106qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for control Hh wild type fibroblast cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347091qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for SJ-GBM2 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347097qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Saos-2 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347092qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for A673 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347096qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for U-2 OS cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347105qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for MG 63 (6-TG R) cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347103qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for OHS-50 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347102qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Rh18 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1346986P-glycoprotein substrates identified in KB-3-1 adenocarcinoma cell line, qHTS therapeutic library screen2019Molecular pharmacology, 11, Volume: 96, Issue:5
A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein.
AID1347095qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for NB-EBc1 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347093qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for SK-N-MC cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347094qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for BT-37 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347089qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for TC32 cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347090qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for DAOY cells2018Oncotarget, Jan-12, Volume: 9, Issue:4
Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing.
AID1347082qHTS for Inhibitors of the Functional Ribonucleoprotein Complex (vRNP) of Lassa (LASV) Arenavirus: LASV Primary Screen - GLuc reporter signal2020Antiviral research, 01, Volume: 173A cell-based, infectious-free, platform to identify inhibitors of lassa virus ribonucleoprotein (vRNP) activity.
AID1508630Primary qHTS for small molecule stabilizers of the endoplasmic reticulum resident proteome: Secreted ER Calcium Modulated Protein (SERCaMP) assay2021Cell reports, 04-27, Volume: 35, Issue:4
A target-agnostic screen identifies approved drugs to stabilize the endoplasmic reticulum-resident proteome.
AID1347160Primary screen NINDS Rhodamine qHTS for Zika virus inhibitors2020Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors.
AID1347159Primary screen GU Rhodamine qHTS for Zika virus inhibitors: Unlinked NS2B-NS3 protease assay2020Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors.
AID1425061Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170535Inhibition of rat JAK12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1170498Half life in dog at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425160Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425203Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708123Inhibition of JAK2 (unknown origin) transfected in mouse BAF3 cells assessed as cell growth inhibition incubated for 72 hrs by CCK8 assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1170499Oral bioavailability in dog at 1 mg/kg, iv and 5 mg/kg2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1709137Inhibition of recombinant human JAK3 assessed as phosphorylation level in presence of 1 mM ATP2021Bioorganic & medicinal chemistry letters, 04-15, Volume: 38Small molecule approaches to treat autoimmune and inflammatory diseases (Part I): Kinase inhibitors.
AID1170512Metabolic stability in dog liver microsomes assessed as compound remaining after 60 mins2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1170505Inhibition of JAK2 in IL3-induced human TF1 cells assessed as pSTAT52014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1467713Binding affinity to wild type JAK2 JH2 domain (unknown origin) at 50 uM by competitive fluorescence polarization assay2017ACS medicinal chemistry letters, Jun-08, Volume: 8, Issue:6
JAK2 JH2 Fluorescence Polarization Assay and Crystal Structures for Complexes with Three Small Molecules.
AID1425128Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425182Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424995Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424986Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170515Half life in dog hepatocytes2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425049Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425076Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424940Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424949Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425080Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898253Plasma protein binding in rat assessed as unbound fraction at 2 uM incubated for 4 hrs by LC/MS/MS based balanced dialysis method2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425023Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424964Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425164Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170514Half life in rat hepatocytes2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424989Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708119Selectivity index, ratio of IC50 for recombinant JAK2 (unknown origin) to IC50 for recombinant JAK1 (unknown origin) using GFP-STAT1 as substrate2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1251061Inhibition of Tyk2 (unknown origin)2015Journal of medicinal chemistry, Sep-24, Volume: 58, Issue:18
Benzimidazole Derivatives as Potent JAK1-Selective Inhibitors.
AID1425071Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424921Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708125Inhibition of TYK2 (unknown origin) transfected in mouse BAF3 cells assessed as cell growth inhibition incubated for 72 hrs by CCK8 assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1425168Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425028Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425030Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425108Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412297Antiarthritic activity in adjuvant-induced SPF LEW/SsNSlc rat arthritis model assessed as paw thickness at 20 mg/kg, po qd measured on day 142018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1425143Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425000Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425199Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898257Metabolic stability in mouse hepatocytes assessed as intrinsic clearance at 1 uM incubated for 90 mins by LC/MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425191Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425093Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425095Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898261Inhibition of CYP2B6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425017Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170480Cmax in rat at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424889Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1251058Inhibition of JAK1 (unknown origin)2015Journal of medicinal chemistry, Sep-24, Volume: 58, Issue:18
Benzimidazole Derivatives as Potent JAK1-Selective Inhibitors.
AID1425163Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1251059Inhibition of JAK2 (unknown origin)2015Journal of medicinal chemistry, Sep-24, Volume: 58, Issue:18
Benzimidazole Derivatives as Potent JAK1-Selective Inhibitors.
AID1425173Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425029Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425047Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425070Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424963Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425081Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170516Half life in human hepatocytes2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425027Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424971Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425178Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1663656Inhibition of JAK3 (unknown origin) in presence of ATP at Km concentration by caliper assay2020Bioorganic & medicinal chemistry letters, 07-15, Volume: 30, Issue:14
Discovery of triazolo [1,5-a] pyridine derivatives as novel JAK1/2 inhibitors.
AID1875947Inhibition of JAK 1 (unknown origin)2022Journal of medicinal chemistry, 01-27, Volume: 65, Issue:2
Recent Developments in the Use of Kinase Inhibitors for Management of Viral Infections.
AID1424942Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424890Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170484Clearance in rat at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425001Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424901Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425148Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424959Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425110Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425073Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425036Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425003Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1663660Inhibition of JAK2 (unknown origin) expressed in mouse BAF3 cells assessed as antiproliferative activity by cell-based assay2020Bioorganic & medicinal chemistry letters, 07-15, Volume: 30, Issue:14
Discovery of triazolo [1,5-a] pyridine derivatives as novel JAK1/2 inhibitors.
AID1170483AUC (0 to infinity) in rat at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425019Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708118Inhibition of recombinant TYK2 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1424902Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898244Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425086Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424973Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425106Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424922Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170524Inhibition of CYP1A2 (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425153Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425113Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898247Selectivity index, ratio of IC50 for inhibition of recombinant human TYK2 to IC50 for inhibition of recombinant human JAK12022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1424970Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425157Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424981Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425051Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424923Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157426Inhibition of JAK1/JAK3 in human whole blood assessed as inhibition of IL-15-induced STAT-5 phosphorylation preincubated for 45 mins followed by IL-15 addition measured after 15 mins by FACS analysis2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1898260Inhibition of CYP1A2 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1424904Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424891Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424988Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425118Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425082Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425010Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425189Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424899Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425192Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424944Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424937Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425033Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898254Microsomal stability in mouse liver microsomes assessed as intrinsic clearance at 1 uM incubated for 60 mins in presence of NADPH regenerating system by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425166Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170495Clearance in dog at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425065Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425141Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170519Thermodynamic solubility in aqueous buffer solution at pH 32014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1898245Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425170Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898265Inhibition of CYP2D6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425159Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424994Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424896Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1876126Cytotoxicity against human Jurkat 6C6-du cells2022Journal of medicinal chemistry, 01-27, Volume: 65, Issue:2
Recent Developments in the Use of Kinase Inhibitors for Management of Viral Infections.
AID1424911Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424916Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425212Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170513Metabolic stability in human liver microsomes assessed as compound remaining after 60 mins2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425177Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424912Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412231Inhibition of human JAK1 using GEEPLYWSFPAKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1424969Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424975Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1875944Inhibition of JAK 2 (unknown origin)2022Journal of medicinal chemistry, 01-27, Volume: 65, Issue:2
Recent Developments in the Use of Kinase Inhibitors for Management of Viral Infections.
AID1170511Metabolic stability in rat liver microsomes assessed as compound remaining after 60 mins2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425096Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425187Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425077Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424893Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425209Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425124Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412234Inhibition of human JAK3 using GGEEEEYFELVKKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1425140Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157429Inhibition of JAK1/TYK2 in human whole blood assessed as inhibition of IFN-alpha-induced STAT-3 phosphorylation preincubated for 45 mins followed by IFN-alpha addition measured after 15 mins by FACS analysis2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1898278Antiarthritic activity in collagen-induced rheumatoid arthritis DBA/1 mouse model assessed as reduction in incidence rate at 15 mg/kg, po BID administered for 14 days starting from 7 days before immunization to 21 days after immunization and measured post2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1170479Cmax in rat at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424933Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425161Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425112Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425101Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424974Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425176Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425122Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157425Inhibition of TYK2 (unknown origin)2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1170522Plasma protein binding in human2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1170523Inhibition of human ERG channel by patch clamp assay2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425052Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425154Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424950Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425149Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425088Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425041Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157431Inhibition of JAK2 homodimer in human CD34+ cells spiked into human whole blood assessed as inhibition of EPO-induced STAT-5 phosphorylation preincubated for 45 mins followed by EPO addition measured after 15 mins by FACS analysis2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1170486Half life in rat at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425138Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1389260Inhibition of human ERG expressed in HEK293 cells by automated patch clamp method2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1708224Inhibition of JAK1 pathway in human TF-1 cells assessed as decrease in IL6-induced STAT3 phosphorylation preincubated for 30 mins followed by IL-6 stimulation and measured after 30 mins by immunoassay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1425045Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425126Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424996Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898279Antiarthritic activity in collagen-induced rheumatoid arthritis DBA/1 mouse model assessed as reduction in clinical score AUC at 15 mg/kg, po BID administered for 14 days starting from 7 days before immunization to 21 days after immunization and measured 2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425072Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424968Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424984Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425206Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425130Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708126Selectivity index, ratio of GI50 for inhibition of JAK2 (unknown origin) transfected in mouse BAF3 cells to GI50 for inhibition of JAK1 (unknown origin) transfected in mouse BAF3 cells2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1898258Metabolic stability in rat hepatocytes assessed as intrinsic clearance at 1 uM incubated for 90 mins by LC/MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425035Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424972Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425194Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412288Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in right hind ankle joint thickness at 100 mg/kg, po qd measured on day 19 by hematoxylin-eosin staining-based assay2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1425038Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425207Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425174Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425134Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157430Inhibition of JAK2/TYK2 in human whole blood assessed as inhibition of IL-23-induced STAT-3 phosphorylation preincubated for 45 mins followed by IL-23 addition measured after 15 mins by FACS analysis2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1424976Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425009Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898282Inhibition of JAK2 signalling in human whole blood assessed as inhibition of GM-CSF stimulated STAT5 phosphorylation in CD33+ monocytes preincubated for 1 hr followed by GM-CSF stimulation and incubated for 20 mins by flow cytometry analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425002Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1389314Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as decrease in IL-6 level in serum at 100 mg/kg, po qd measured on day 19 post dose by ELISA2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1424905Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170529Inhibition of human FLT3 (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424907Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425016Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425123Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425034Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425111Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425048Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170454Inhibition of human recombinant JAK12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1898262Inhibition of CYP2C8 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1170506Inhibition of JAK2 in IL3-induced human BaF3 cells assessed as cell proliferation2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424948Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425188Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424956Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170534Antiinflammatory activity in rat collagen-induced arthritis model assessed as reduction in clinical score at 0.3 mg/kg, po measured up to day 152014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425150Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170518Efflux ratio of permeability across basolateral to apical side over apical to basolateral side in human Caco2 cells2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425099Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170496Volume of distribution at steady state in dog at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425201Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425144Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425196Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425018Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425186Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424947Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170482AUC (0 to infinity) in rat at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425043Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425146Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425179Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1251064Selectivity ratio of IC50 for Tyk2 (unknown origin) to IC50 for JAK1 (unknown origin)2015Journal of medicinal chemistry, Sep-24, Volume: 58, Issue:18
Benzimidazole Derivatives as Potent JAK1-Selective Inhibitors.
AID1170477Kinetic solubility of the compound at pH 7.42014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425181Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1389319Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as increase in thickness of articular surface cartilage at 100 mg/kg, po qd measured on day 19 post dose by hematoxylin-eosin staining based assay2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1425069Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424929Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425059Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170525Inhibition of CYP2C9 (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425208Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424892Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425064Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157428Inhibition of JAK2/TYK2 in human whole blood assessed as inhibition of IL-12-induced STAT-4 phosphorylation preincubated for 45 mins followed by IL-12 addition measured after 15 mins by FACS analysis2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1424961Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425210Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425158Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425193Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424985Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170474Selectivity index, ratio of IC50 for human recombinant JAK2 to IC50 for human recombinant JAK12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425078Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425152Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157422Inhibition of JAK1 (unknown origin)2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1170521Plasma protein binding in dog2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425056Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170491Cmax in dog at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1170493AUC (0 to infinity) in dog at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1708116Inhibition of recombinant JAK2 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1424977Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424909Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424926Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425121Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898252Plasma protein binding in mouse assessed as unbound fraction at 2 uM incubated for 4 hrs by LC/MS/MS based balanced dialysis method2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1424928Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424914Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898264Inhibition of CYP2C19 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425197Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425014Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424967Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898248Apparent permeability across apical to basolateral side in human Caco-2 cells at 10 uM measured after 120 mins by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425107Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1663655Inhibition of JAK2 (unknown origin) in presence of ATP at Km concentration by caliper assay2020Bioorganic & medicinal chemistry letters, 07-15, Volume: 30, Issue:14
Discovery of triazolo [1,5-a] pyridine derivatives as novel JAK1/2 inhibitors.
AID1424954Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170494AUC (0 to infinity) in dog at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425129Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1157427Inhibition of JAK1/JAK2/TYK2 in human whole blood assessed as inhibition of IL-6-induced STAT-1 phosphorylation preincubated for 45 mins followed by IL-6 addition measured after 15 mins by FACS analysis2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1425060Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425127Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412285Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in clinical arthritis score at 100 mg/kg, po qd measured twice weekly for 18 days2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1170508Inhibition of JAK2 in PRL-induced human 22Rv1 cells assessed as pSTAT52014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424953Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425007Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425085Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424998Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1389320Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as decrease in inflammatory cell infiltration in ankle joint at 100 mg/kg, po qd measured on day 19 post dose2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1425090Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170530Inhibition of human FLT4 (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424931Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425180Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898266Inhibition of CYP3A4 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1424915Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425162Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170487Half life in rat at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425053Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425100Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424952Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708128Selectivity index, ratio of GI50 for inhibition of TYK2 (unknown origin) transfected in mouse BAF3 cells to GI50 for inhibition of JAK1 (unknown origin) transfected in mouse BAF3 cells2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1425156Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708225Inhibition of JAK2 pathway in human TF-1 cells assessed as decrease in IL3-induced STAT5 phosphorylation preincubated for 1 hr followed by IL-3 stimulation and measured after 20 mins by immunoassay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1412292Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in serum IL-6 levels at 100 mg/kg, po qd measured on day 19 by ELISA2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1170509Inhibition of JAK1 in human whole blood assessed as inhibition of IL-6-induced pSTAT12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425006Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412293Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in serum TNF-alpha levels at 100 mg/kg, po qd measured on day 19 by ELISA2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1424980Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424919Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425024Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425116Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424918Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898243Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1424930Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170533Antiinflammatory activity in rat collagen-induced arthritis model assessed as reduction in clinical score at 0.1 mg/kg, po measured up to day 152014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424993Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170490Cmax in dog at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425105Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898283Inhibition of JAK1/JAK3 signalling in human whole blood assessed as inhibition of IL-2 stimulated STAT5 phosphorylation in CD4+ lymphocytes preincubated for 1 hr followed by IL-2 stimulation and incubated for 20 mins by flow cytometry analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425190Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425037Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170527Inhibition of CYP3A4 (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1170517Permeability across apical to basolateral side in human Caco2 cells2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1389328Antiarthritic activity in Lewis rat Freund's adjuvant-induced arthritis model assessed as reduction in arthritis index score at 20 mg/kg, po qd measured twice weekly for 14 days2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1424898Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425046Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425115Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170476Selectivity index, ratio of IC50 for human recombinant TYK2 to IC50 for human recombinant JAK12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425117Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424939Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170500Inhibition of JAK1/JAK3 in IL4-induced human THP1 cells assessed as pSTAT62014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1898281Inhibition of JAK1/JAK2/TYK2 signalling in human whole blood assessed as inhibition of IL-6 stimulated STAT1 phosphorylation in CD4+ lymphocytes preincubated for 1 hr followed by IL-6 stimulation and incubated for 20 mins by flow cytometry analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425213Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425109Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170492Tmax in dog at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424906Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424945Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708115Inhibition of recombinant JAK1 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1898242Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425054Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170504Inhibition of JAK1/JAK2 in IFNgamma-induced human THP1 cells assessed as pSTAT12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425022Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425026Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425040Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424895Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708124Inhibition of JAK3 (unknown origin) transfected in mouse BAF3 cells assessed as cell growth inhibition incubated for 72 hrs by CCK8 assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1389318Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as decrease in thickness of ankle joint at 100 mg/kg, po qd measured on day 19 post dose by hematoxylin-eosin staining based assay2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1898284Inhibition of JAK1/TYK2 signalling in human whole blood assessed as inhibition of IFN-alpha stimulated STAT1 phosphorylation in CD4+ lymphocytes preincubated for 1 hr followed by IFN-alpha stimulation and incubated for 20 mins by flow cytometry analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1389316Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as decrease in bone surface/volume ratio at 100 mg/kg, po qd measured on day 19 post dose by micro-CT method2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1424910Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425042Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170526Inhibition of CYP2D6 (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425063Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425062Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425151Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425079Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425137Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425142Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1251063Selectivity ratio of IC50 for JAK3 (unknown origin) to IC50 for JAK1 (unknown origin)2015Journal of medicinal chemistry, Sep-24, Volume: 58, Issue:18
Benzimidazole Derivatives as Potent JAK1-Selective Inhibitors.
AID1424990Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425020Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425068Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1663659Inhibition of JAK1 (unknown origin) expressed in mouse BAF3 cells assessed as antiproliferative activity by cell-based assay2020Bioorganic & medicinal chemistry letters, 07-15, Volume: 30, Issue:14
Discovery of triazolo [1,5-a] pyridine derivatives as novel JAK1/2 inhibitors.
AID1424917Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425008Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425098Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170481Tmax in rat at 5 mg/kg, po2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424946Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708122Inhibition of JAK1 (unknown origin) transfected in mouse BAF3 cells assessed as cell growth inhibition incubated for 72 hrs by CCK8 assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1425097Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170502Inhibition of JAK1/TYK2 in IFN-alphaB2-induced human U2OS cells assessed as pSTAT12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424991Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424925Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170507Inhibition of JAK2 in EPO-induced human UT7-EPO cells assessed as pSTAT52014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424992Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425136Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708223Inhibition of TNFbeta-induced cell migration in human LX2 cells at 500 nM after 24 hrs by scratch wound healing assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1425131Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425021Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1663654Inhibition of JAK1 (unknown origin) in presence of ATP at Km concentration by caliper assay2020Bioorganic & medicinal chemistry letters, 07-15, Volume: 30, Issue:14
Discovery of triazolo [1,5-a] pyridine derivatives as novel JAK1/2 inhibitors.
AID1876079Antiviral activity against HIV2022Journal of medicinal chemistry, 01-27, Volume: 65, Issue:2
Recent Developments in the Use of Kinase Inhibitors for Management of Viral Infections.
AID1170503Inhibition of JAK1/JAK2 in OSM-induced human HeLa cells assessed as STAT1 reporter2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1170510Inhibition of JAK2 in human whole blood assessed as inhibition of GM-CSF-induced pSTAT52014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425145Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898249Apparent permeability across basolateral to apical side in human Caco-2 cells at 10 uM measured after 120 mins by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1424913Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424900Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412298Antiarthritic activity in adjuvant-induced SPF LEW/SsNSlc rat arthritis model assessed as decrease in clinical arthritis score at 20 mg/kg, po qd measured on day 142018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1425050Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1709138Inhibition of recombinant human Tyk2 expressed in sf21 baculovirus expression system assessed as phosphorylation level in presence of 1 mM ATP2021Bioorganic & medicinal chemistry letters, 04-15, Volume: 38Small molecule approaches to treat autoimmune and inflammatory diseases (Part I): Kinase inhibitors.
AID1170497Half life in dog at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1389329Antiarthritic activity in Lewis rat Freund's adjuvant-induced arthritis model assessed as reduction in paw volume at 20 mg/kg, po qd measured twice weekly for 14 days by electric caliper method2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1898256Microsomal stability in human liver microsomes assessed as intrinsic clearance at 1 uM incubated for 60 mins in presence of NADPH regenerating system by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425074Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1251060Inhibition of JAK3 (unknown origin)2015Journal of medicinal chemistry, Sep-24, Volume: 58, Issue:18
Benzimidazole Derivatives as Potent JAK1-Selective Inhibitors.
AID1425103Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1389317Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as decrease in semiquantitative score of ankle joint at 100 mg/kg, po qd measured on day 19 post dose by hematoxylin-eosin staining based assay2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1424962Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898255Microsomal stability in rat liver microsomes assessed as intrinsic clearance at 1 uM incubated for 60 mins in presence of NADPH regenerating system by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425039Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425172Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1709135Inhibition of recombinant human JAK1 assessed as phosphorylation level in presence of 1 mM ATP2021Bioorganic & medicinal chemistry letters, 04-15, Volume: 38Small molecule approaches to treat autoimmune and inflammatory diseases (Part I): Kinase inhibitors.
AID1708120Selectivity index, ratio of IC50 for recombinant JAK3 (unknown origin) to IC50 for recombinant JAK1 (unknown origin) using GFP-STAT1 as substrate2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1389315Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as decrease in TNF-alpha level in serum at 100 mg/kg, po qd measured on day 19 post dose by ELISA2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1708117Inhibition of recombinant JAK3 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1424966Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425155Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425200Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425094Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424935Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425167Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170531Inhibition of human CSF1R (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424908Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425089Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898251Plasma protein binding in human assessed as unbound fraction at 2 uM incubated for 4 hrs by LC/MS/MS based balanced dialysis method2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1425147Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425044Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424960Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424979Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170520Thermodynamic solubility in aqueous buffer solution at pH 7.42014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425067Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425084Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425104Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1708121Selectivity index, ratio of IC50 for recombinant TYK2 (unknown origin) to IC50 for recombinant JAK1 (unknown origin) using GFP-STAT1 as substrate2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1425133Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412287Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in ratio of bone surface to bone volume of right hind ankle joint at 100 mg/kg, po qd measured on day 19 by micro-CT analysis2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1425125Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424999Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425211Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898263Inhibition of CYP2C9 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1157423Inhibition of JAK2 (unknown origin)2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1708127Selectivity index, ratio of GI50 for inhibition of JAK3 (unknown origin) transfected in mouse BAF3 cells to GI50 for inhibition of JAK1 (unknown origin) transfected in mouse BAF3 cells2021Journal of medicinal chemistry, 01-28, Volume: 64, Issue:2
Discovery and Biological Evaluation of
AID1425184Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898246Selectivity index, ratio of IC50 for inhibition of recombinant human JAK2 to IC50 for inhibition of recombinant human JAK12022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1170501Inhibition of JAK1/JAK3 in IL2-induced human NK92 cells assessed as pSTAT52014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424941Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425165Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425004Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412235Inhibition of human TYK2 using GGMEDIYFEFMGGKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1170528Inhibition of CYP2C19 (unknown origin)2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424978Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170485Volume of distribution at steady state in rat at 1 mg/kg, iv2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424987Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424934Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170532Antiinflammatory activity in po dosed rat collagen-induced arthritis model assessed as reduction in clinical score measured up to day 152014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1424958Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424924Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412289Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in articular surface cartilage thickness in right hind ankle joints at 100 mg/kg, po qd measured on day 19 by hematoxylin-eosin staining-based assay2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1663661Inhibition of JAK3 (unknown origin) expressed in mouse BAF3 cells assessed as antiproliferative activity by cell-based assay2020Bioorganic & medicinal chemistry letters, 07-15, Volume: 30, Issue:14
Discovery of triazolo [1,5-a] pyridine derivatives as novel JAK1/2 inhibitors.
AID1425169Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424894Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1251062Selectivity ratio of IC50 for JAK2 (unknown origin) to IC50 for JAK1 (unknown origin)2015Journal of medicinal chemistry, Sep-24, Volume: 58, Issue:18
Benzimidazole Derivatives as Potent JAK1-Selective Inhibitors.
AID1424965Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1170478Plasma protein binding in rat2014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425185Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425058Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424997Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425204Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898250Efflux ratio of apparent permeability from basolateral to apical side over apical to basolateral side in human Caco-2 cells at 10 uM incubated for 120 mins by LC-MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1412252Inhibition of human ERG expressed in HEK293 cells after 5 mins by automated planar patch clamp method2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1425057Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424983Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898259Metabolic stability in human hepatocytes assessed as intrinsic clearance at 1 uM incubated for 90 mins by LC/MS/MS analysis2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1157424Inhibition of JAK3 (unknown origin)2014Journal of medicinal chemistry, Jun-26, Volume: 57, Issue:12
Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.
AID1425087Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1898285Selectivity index, ratio of IC50 for inhibition of JAK2 signalling in human whole blood assessed as inhibition of GM-CSF stimulated STAT5 phosphorylation in CD33+ lymphocytes to IC50 for inhibition of JAK1/JAK2/TYK2 signalling in human whole blood assesse2022Journal of medicinal chemistry, 12-22, Volume: 65, Issue:24
Identification of TUL01101: A Novel Potent and Selective JAK1 Inhibitor for the Treatment of Rheumatoid Arthritis.
AID1170475Selectivity index, ratio of IC50 for human recombinant JAK3 to IC50 for human recombinant JAK12014Journal of medicinal chemistry, Nov-26, Volume: 57, Issue:22
Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634.
AID1425025Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1709136Inhibition of recombinant human JAK2 assessed as phosphorylation level in presence of 1 mM ATP2021Bioorganic & medicinal chemistry letters, 04-15, Volume: 38Small molecule approaches to treat autoimmune and inflammatory diseases (Part I): Kinase inhibitors.
AID1412232Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1389312Antiarthritic activity in DBA1/J mouse type-2 collagen-induced arthritis model assessed as reduction in arthritis index score at 100 mg/kg, po qd measured twice weekly for 18 days2018Bioorganic & medicinal chemistry, 05-01, Volume: 26, Issue:8
Development of selective inhibitors for the treatment of rheumatoid arthritis: (R)-3-(3-(Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)pyrrolidin-1-yl)-3-oxopropanenitrile as a JAK1-selective inhibitor.
AID1425171Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425083Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425120Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1424920Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425055Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425175Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1425013Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry2017Science (New York, N.Y.), 12-01, Volume: 358, Issue:6367
The target landscape of clinical kinase drugs.
AID1412286Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in paw volume at 100 mg/kg, po qd measured on day 1 and 18 by plethysmometer2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1412290Antiarthritic activity in collagen-induced DBA1/J mouse arthritis model assessed as decrease in infiltration of inflammatory cells in right hind ankle joints at 100 mg/kg, po qd measured on day 19 by hematoxylin-eosin staining-based assay2018MedChemComm, Mar-01, Volume: 9, Issue:3
Design, synthesis and evaluation of (
AID1347411qHTS to identify inhibitors of the type 1 interferon - major histocompatibility complex class I in skeletal muscle: primary screen against the NCATS Mechanism Interrogation Plate v5.0 (MIPE) Libary2020ACS chemical biology, 07-17, Volume: 15, Issue:7
High-Throughput Screening to Identify Inhibitors of the Type I Interferon-Major Histocompatibility Complex Class I Pathway in Skeletal Muscle.
AID1347414qHTS to identify inhibitors of the type 1 interferon - major histocompatibility complex class I in skeletal muscle: Secondary screen by immunofluorescence2020ACS chemical biology, 07-17, Volume: 15, Issue:7
High-Throughput Screening to Identify Inhibitors of the Type I Interferon-Major Histocompatibility Complex Class I Pathway in Skeletal Muscle.
AID1347415qHTS to identify inhibitors of the type 1 interferon - major histocompatibility complex class I in skeletal muscle: tertiary screen by RT-qPCR2020ACS chemical biology, 07-17, Volume: 15, Issue:7
High-Throughput Screening to Identify Inhibitors of the Type I Interferon-Major Histocompatibility Complex Class I Pathway in Skeletal Muscle.
AID1345757Human Janus kinase 1 (Janus kinase (JakA) family)2013Journal of immunology (Baltimore, Md. : 1950), Oct-01, Volume: 191, Issue:7
Preclinical characterization of GLPG0634, a selective inhibitor of JAK1, for the treatment of inflammatory diseases.
AID1345872Human tyrosine kinase 2 (Janus kinase (JakA) family)2013Journal of immunology (Baltimore, Md. : 1950), Oct-01, Volume: 191, Issue:7
Preclinical characterization of GLPG0634, a selective inhibitor of JAK1, for the treatment of inflammatory diseases.
AID1345714Human Janus kinase 2 (Janus kinase (JakA) family)2013Journal of immunology (Baltimore, Md. : 1950), Oct-01, Volume: 191, Issue:7
Preclinical characterization of GLPG0634, a selective inhibitor of JAK1, for the treatment of inflammatory diseases.
AID1345744Human Janus kinase 3 (Janus kinase (JakA) family)2013Journal of immunology (Baltimore, Md. : 1950), Oct-01, Volume: 191, Issue:7
Preclinical characterization of GLPG0634, a selective inhibitor of JAK1, for the treatment of inflammatory diseases.
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023]

Research

Studies (134)

TimeframeStudies, This Drug (%)All Drugs %
pre-19900 (0.00)18.7374
1990's0 (0.00)18.2507
2000's0 (0.00)29.6817
2010's40 (29.85)24.3611
2020's94 (70.15)2.80
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Market Indicators

Research Demand Index: 20.26

According to the monthly volume, diversity, and competition of internet searches for this compound, as well the volume and growth of publications, there is estimated to be moderate demand-to-supply ratio for research on this compound.

MetricThis Compound (vs All)
Research Demand Index20.26 (24.57)
Research Supply Index5.15 (2.92)
Research Growth Index4.83 (4.65)
Search Engine Demand Index21.17 (26.88)
Search Engine Supply Index2.00 (0.95)

This Compound (20.26)

All Compounds (24.57)

Study Types

Publication TypeThis drug (%)All Drugs (%)
Trials37 (27.61%)5.53%
Reviews44 (32.84%)6.00%
Case Studies1 (0.75%)4.05%
Observational0 (0.00%)0.25%
Other52 (38.81%)84.16%
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]