Page last updated: 2024-12-11

fr 148083

Description

5Z-7-oxozeaenol : A macrolide that is the 7-oxo derivative of zeaenol (the 5Z stereoisomer). Isolated from Fungi, it exhibits cytotoxic, antibacterial and inhibitory activity against NF-kappaB. [Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Cross-References

ID SourceID
PubMed CID9863776
CHEMBL ID1077979
CHEBI ID67559
CHEBI ID95343
SCHEMBL ID3841555
MeSH IDM0507582

Synonyms (26)

Synonym
bdbm50042034
5z-7-oxozeaenol
CHEMBL1077979 ,
chebi:67559 ,
NCGC00186421-04
NCGC00186421-03
NCGC00244249-02
fr148083
fr-148083
ll-z1640-2
(3s,5z,8s,9s,11e)-8,9,16-trihydroxy-14-methoxy-3-methyl-3,4,9,10-tetrahydro-1h-2-benzoxacyclotetradecine-1,7(8h)-dione
gtpl8077
(2e,5s,6s,8z,11s)-5,6,15-trihydroxy-17-methoxy-11-methyl-12-oxabicyclo[12.4.0]octadeca-1(14),2,8,15,17-pentaene-7,13-dione
SCHEMBL3841555
(3s,5z,8s,9s,11e)-3,4,9,10-tetrahydro-8,9,16-trihydroxy-14-methoxy-3-methyl-1h-2-benzoxacyclotetradecin-1,7(8h)-dione
DTXSID90432058
AKOS030213203
CHEBI:95343
5z-7-oxozeaenol, >=98% (hplc)
NCGC00186421-07
Q27074007
HY-12686
CS-0012266
(4s,6z,9s,10s,12e)-9,10,18-trihydroxy-16-methoxy-4-methyl-3-oxabicyclo[12.4.0]octadeca-1(14),6,12,15,17-pentaene-2,8-dione
ll-z 1640-2
l783279

Research Excerpts

Bioavailability

ExcerptReferenceRelevance
"The ATP-binding cassette transporter P-glycoprotein (P-gp) is known to limit both brain penetration and oral bioavailability of many chemotherapy drugs."( A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein.
Ambudkar, SV; Brimacombe, KR; Chen, L; Gottesman, MM; Guha, R; Hall, MD; Klumpp-Thomas, C; Lee, OW; Lee, TD; Lusvarghi, S; Robey, RW; Shen, M; Tebase, BG, 2019
)
0.51
[information is derived through text-mining from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Roles (4)

RoleDescription
metaboliteAny intermediate or product resulting from metabolism. The term 'metabolite' subsumes the classes commonly known as primary and secondary metabolites.
antibacterial agentA substance (or active part thereof) that kills or slows the growth of bacteria.
antineoplastic agentA substance that inhibits or prevents the proliferation of neoplasms.
NF-kappaB inhibitorAn inhibitor of NF-kappaB (nuclear factor kappa-light-chain-enhancer of activated B cells), a protein complex involved in the transcription of DNA.
[role information is derived from Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Drug Classes (5)

ClassDescription
aromatic etherAny ether in which the oxygen is attached to at least one aryl substituent.
macrolideA macrocyclic lactone with a ring of twelve or more members derived from a polyketide.
phenolsOrganic aromatic compounds having one or more hydroxy groups attached to a benzene or other arene ring.
secondary alcoholA secondary alcohol is a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom which has two other carbon atoms attached to it.
secondary alpha-hydroxy ketoneAn alpha-hydroxy ketone in which the carbonyl group and the hydroxy group are linked by a carbon bearing one hydrogen and one organyl group. Secondary alpha-hydroxy ketones are also known as acyloins, and are formally derived from reductive coupling of two carboxylic acid groups.
[compound class information is derived from Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Protein Targets (11)

Potency Measurements

ProteinTaxonomyMeasurementAverage (µ)Min (ref.)Avg (ref.)Max (ref.)Bioassay(s)
tyrosine-protein kinase YesHomo sapiens (human)Potency2.44240.00005.018279.2586AID686947
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Inhibition Measurements

ProteinTaxonomyMeasurementAverageMin (ref.)Avg (ref.)Max (ref.)Bioassay(s)
Dual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)IC50 (µMol)0.80000.00100.34191.3000AID1176812; AID719899
Mitogen-activated protein kinase kinase kinase 7Homo sapiens (human)IC50 (µMol)0.01700.00560.24702.6000AID1176815; AID1254042; AID1254043; AID1311909; AID1336652; AID1490296; AID1613078; AID589426
Mitogen-activated protein kinase 1Homo sapiens (human)IC50 (µMol)2.53930.00031.68789.2000AID1176814; AID1336654; AID719897
Dual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)IC50 (µMol)3.00000.00100.74731.6000AID719900
Nuclear receptor subfamily 2 group C member 2Homo sapiens (human)IC50 (µMol)0.00900.00900.01950.0300AID1772487
Dual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)IC50 (µMol)0.02960.00020.68139.7000AID1176813; AID1336653; AID719898
Transcription factor p65Homo sapiens (human)IC50 (µMol)0.25000.00011.89818.8000AID606031
TGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)IC50 (µMol)0.00870.00800.14710.9000AID1613078; AID1772487; AID589426
Phospholipase A-2-activating proteinHomo sapiens (human)IC50 (µMol)0.01100.01101.53702.5000AID1469808
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Activation Measurements

ProteinTaxonomyMeasurementAverageMin (ref.)Avg (ref.)Max (ref.)Bioassay(s)
BMP-2-inducible protein kinaseHomo sapiens (human)Kd0.00380.00222.409756.0320AID1876268
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Other Measurements

ProteinTaxonomyMeasurementAverageMin (ref.)Avg (ref.)Max (ref.)Bioassay(s)
Nuclear receptor subfamily 2 group C member 2Homo sapiens (human)INH0.00600.00600.00600.0060AID652590
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Biological Processes (227)

Processvia Protein(s)Taxonomy
apoptotic processDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
response to osmotic stressDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
JNK cascadeDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
response to heatDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
response to UVDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
response to woundingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
response to tumor necrosis factorDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
Fc-epsilon receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
positive regulation of JUN kinase activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
positive regulation of DNA-templated transcriptionDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
positive regulation of JNK cascadeDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
stress-activated MAPK cascadeDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
positive regulation of telomerase activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
cellular response to lipopolysaccharideDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
cellular response to interleukin-1Dual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
cellular senescenceDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
positive regulation of telomere cappingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
regulation of motor neuron apoptotic processDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
stimulatory C-type lectin receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of T cell cytokine productionMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
cytoplasmic pattern recognition receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
MyD88-dependent toll-like receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
chromatin remodelingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
inflammatory responseMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
transforming growth factor beta receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
canonical NF-kappaB signal transductionMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
I-kappaB phosphorylationMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
negative regulation of gene expressionMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of macroautophagyMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of interleukin-2 productionMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
toll-like receptor 3 signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
toll-like receptor 4 signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
TRIF-dependent toll-like receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
nucleotide-binding domain, leucine rich repeat containing receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
p38MAPK cascadeMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
Fc-epsilon receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
interleukin-33-mediated signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
interleukin-17A-mediated signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
defense response to bacteriumMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
anoikisMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of JUN kinase activityMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of cell cycleMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of cell sizeMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
T cell receptor signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
interleukin-1-mediated signaling pathwayMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
cellular response to tumor necrosis factorMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
cellular response to hypoxiaMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of non-canonical NF-kappaB signal transductionMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
cellular response to angiotensinMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell migrationMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
immune responseMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
positive regulation of macrophage chemotaxisMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of macrophage proliferationMitogen-activated protein kinase 1Homo sapiens (human)
regulation of transcription by RNA polymerase IIMitogen-activated protein kinase 1Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
apoptotic processMitogen-activated protein kinase 1Homo sapiens (human)
chemotaxisMitogen-activated protein kinase 1Homo sapiens (human)
DNA damage responseMitogen-activated protein kinase 1Homo sapiens (human)
signal transductionMitogen-activated protein kinase 1Homo sapiens (human)
chemical synaptic transmissionMitogen-activated protein kinase 1Homo sapiens (human)
learning or memoryMitogen-activated protein kinase 1Homo sapiens (human)
insulin receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of peptidyl-threonine phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
Schwann cell developmentMitogen-activated protein kinase 1Homo sapiens (human)
peptidyl-serine phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
peptidyl-threonine phosphorylationMitogen-activated protein kinase 1Homo sapiens (human)
cytosine metabolic processMitogen-activated protein kinase 1Homo sapiens (human)
regulation of ossificationMitogen-activated protein kinase 1Homo sapiens (human)
androgen receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
regulation of cellular pHMitogen-activated protein kinase 1Homo sapiens (human)
thyroid gland developmentMitogen-activated protein kinase 1Homo sapiens (human)
regulation of protein stabilityMitogen-activated protein kinase 1Homo sapiens (human)
lipopolysaccharide-mediated signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of telomere maintenance via telomeraseMitogen-activated protein kinase 1Homo sapiens (human)
regulation of stress-activated MAPK cascadeMitogen-activated protein kinase 1Homo sapiens (human)
mammary gland epithelial cell proliferationMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to amino acid starvationMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to reactive oxygen speciesMitogen-activated protein kinase 1Homo sapiens (human)
response to nicotineMitogen-activated protein kinase 1Homo sapiens (human)
ERBB signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
ERBB2-ERBB3 signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
outer ear morphogenesisMitogen-activated protein kinase 1Homo sapiens (human)
myelinationMitogen-activated protein kinase 1Homo sapiens (human)
response to exogenous dsRNAMitogen-activated protein kinase 1Homo sapiens (human)
steroid hormone mediated signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
negative regulation of cell differentiationMitogen-activated protein kinase 1Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
thymus developmentMitogen-activated protein kinase 1Homo sapiens (human)
progesterone receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
T cell receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
B cell receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase 1Homo sapiens (human)
regulation of cytoskeleton organizationMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of telomerase activityMitogen-activated protein kinase 1Homo sapiens (human)
Bergmann glial cell differentiationMitogen-activated protein kinase 1Homo sapiens (human)
long-term synaptic potentiationMitogen-activated protein kinase 1Homo sapiens (human)
face developmentMitogen-activated protein kinase 1Homo sapiens (human)
lung morphogenesisMitogen-activated protein kinase 1Homo sapiens (human)
trachea formationMitogen-activated protein kinase 1Homo sapiens (human)
labyrinthine layer blood vessel developmentMitogen-activated protein kinase 1Homo sapiens (human)
cardiac neural crest cell development involved in heart developmentMitogen-activated protein kinase 1Homo sapiens (human)
ERK1 and ERK2 cascadeMitogen-activated protein kinase 1Homo sapiens (human)
response to epidermal growth factorMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to cadmium ionMitogen-activated protein kinase 1Homo sapiens (human)
cellular response to tumor necrosis factorMitogen-activated protein kinase 1Homo sapiens (human)
caveolin-mediated endocytosisMitogen-activated protein kinase 1Homo sapiens (human)
regulation of Golgi inheritanceMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of telomere cappingMitogen-activated protein kinase 1Homo sapiens (human)
regulation of early endosome to late endosome transportMitogen-activated protein kinase 1Homo sapiens (human)
cell surface receptor signaling pathwayMitogen-activated protein kinase 1Homo sapiens (human)
intracellular signal transductionMitogen-activated protein kinase 1Homo sapiens (human)
positive regulation of protein phosphorylationDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
JNK cascadeDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
response to woundingDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
smooth muscle cell apoptotic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to hydrogen peroxideDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
Fc-epsilon receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of neuron apoptotic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of DNA replicationDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of JNK cascadeDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
positive regulation of nitric-oxide synthase biosynthetic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cell growth involved in cardiac muscle cell developmentDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cellular response to mechanical stimulusDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cellular response to sorbitolDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cellular senescenceDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
negative regulation of motor neuron apoptotic processDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
negative regulation of transcription by RNA polymerase IINuclear receptor subfamily 2 group C member 2Homo sapiens (human)
regulation of DNA-templated transcriptionNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
spermatogenesisNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
nervous system developmentNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
intracellular receptor signaling pathwayNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
positive regulation of transcription by RNA polymerase IINuclear receptor subfamily 2 group C member 2Homo sapiens (human)
anatomical structure developmentNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
cell differentiationNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
positive regulation of embryonic developmentNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
chemotaxisDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
signal transductionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
heart developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
negative regulation of cell population proliferationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of gene expressionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
Schwann cell developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cerebellar cortex formationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
keratinocyte differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
thyroid gland developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of stress-activated MAPK cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
endodermal cell differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
ERBB2-ERBB3 signaling pathwayDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
myelinationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
type B pancreatic cell proliferationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of DNA-templated transcriptionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
thymus developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of axon regenerationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cell motilityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of axonogenesisDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
Bergmann glial cell differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
face developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
trachea formationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
epithelial cell proliferation involved in lung morphogenesisDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
placenta blood vessel developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
labyrinthine layer developmentDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
ERK1 and ERK2 cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of Golgi inheritanceDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cellular senescenceDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of endodermal cell differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
regulation of early endosome to late endosome transportDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
neuron differentiationDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
MAPK cascadeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
positive regulation of interleukin-1 beta productionTranscription factor p65Homo sapiens (human)
positive regulation of interleukin-6 productionTranscription factor p65Homo sapiens (human)
positive regulation of interleukin-8 productionTranscription factor p65Homo sapiens (human)
positive regulation of amyloid-beta formationTranscription factor p65Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityTranscription factor p65Homo sapiens (human)
nucleotide-binding oligomerization domain containing 2 signaling pathwayTranscription factor p65Homo sapiens (human)
negative regulation of transcription by RNA polymerase IITranscription factor p65Homo sapiens (human)
liver developmentTranscription factor p65Homo sapiens (human)
hair follicle developmentTranscription factor p65Homo sapiens (human)
defense response to tumor cellTranscription factor p65Homo sapiens (human)
response to ischemiaTranscription factor p65Homo sapiens (human)
acetaldehyde metabolic processTranscription factor p65Homo sapiens (human)
chromatin organizationTranscription factor p65Homo sapiens (human)
DNA-templated transcriptionTranscription factor p65Homo sapiens (human)
regulation of DNA-templated transcriptionTranscription factor p65Homo sapiens (human)
regulation of transcription by RNA polymerase IITranscription factor p65Homo sapiens (human)
inflammatory responseTranscription factor p65Homo sapiens (human)
cellular defense responseTranscription factor p65Homo sapiens (human)
neuropeptide signaling pathwayTranscription factor p65Homo sapiens (human)
canonical NF-kappaB signal transductionTranscription factor p65Homo sapiens (human)
positive regulation of cell population proliferationTranscription factor p65Homo sapiens (human)
response to xenobiotic stimulusTranscription factor p65Homo sapiens (human)
animal organ morphogenesisTranscription factor p65Homo sapiens (human)
response to UV-BTranscription factor p65Homo sapiens (human)
positive regulation of vascular endothelial growth factor productionTranscription factor p65Homo sapiens (human)
positive regulation of gene expressionTranscription factor p65Homo sapiens (human)
positive regulation of Schwann cell differentiationTranscription factor p65Homo sapiens (human)
negative regulation of angiogenesisTranscription factor p65Homo sapiens (human)
cytokine-mediated signaling pathwayTranscription factor p65Homo sapiens (human)
protein catabolic processTranscription factor p65Homo sapiens (human)
response to muramyl dipeptideTranscription factor p65Homo sapiens (human)
response to progesteroneTranscription factor p65Homo sapiens (human)
positive regulation of interleukin-12 productionTranscription factor p65Homo sapiens (human)
positive regulation of interleukin-6 productionTranscription factor p65Homo sapiens (human)
positive regulation of interleukin-8 productionTranscription factor p65Homo sapiens (human)
response to insulinTranscription factor p65Homo sapiens (human)
tumor necrosis factor-mediated signaling pathwayTranscription factor p65Homo sapiens (human)
negative regulation of protein sumoylationTranscription factor p65Homo sapiens (human)
response to cobalaminTranscription factor p65Homo sapiens (human)
toll-like receptor 4 signaling pathwayTranscription factor p65Homo sapiens (human)
intracellular signal transductionTranscription factor p65Homo sapiens (human)
cellular response to hepatocyte growth factor stimulusTranscription factor p65Homo sapiens (human)
response to muscle stretchTranscription factor p65Homo sapiens (human)
non-canonical NF-kappaB signal transductionTranscription factor p65Homo sapiens (human)
vascular endothelial growth factor signaling pathwayTranscription factor p65Homo sapiens (human)
prolactin signaling pathwayTranscription factor p65Homo sapiens (human)
negative regulation of protein catabolic processTranscription factor p65Homo sapiens (human)
negative regulation of apoptotic processTranscription factor p65Homo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionTranscription factor p65Homo sapiens (human)
response to amino acidTranscription factor p65Homo sapiens (human)
negative regulation of DNA-templated transcriptionTranscription factor p65Homo sapiens (human)
positive regulation of DNA-templated transcriptionTranscription factor p65Homo sapiens (human)
positive regulation of transcription by RNA polymerase IITranscription factor p65Homo sapiens (human)
negative regulation of insulin receptor signaling pathwayTranscription factor p65Homo sapiens (human)
regulation of inflammatory responseTranscription factor p65Homo sapiens (human)
positive regulation of T cell receptor signaling pathwayTranscription factor p65Homo sapiens (human)
positive regulation of NF-kappaB transcription factor activityTranscription factor p65Homo sapiens (human)
response to cAMPTranscription factor p65Homo sapiens (human)
defense response to virusTranscription factor p65Homo sapiens (human)
cellular response to hydrogen peroxideTranscription factor p65Homo sapiens (human)
interleukin-1-mediated signaling pathwayTranscription factor p65Homo sapiens (human)
response to interleukin-1Transcription factor p65Homo sapiens (human)
cellular response to lipopolysaccharideTranscription factor p65Homo sapiens (human)
cellular response to lipoteichoic acidTranscription factor p65Homo sapiens (human)
cellular response to peptidoglycanTranscription factor p65Homo sapiens (human)
cellular response to nicotineTranscription factor p65Homo sapiens (human)
cellular response to interleukin-1Transcription factor p65Homo sapiens (human)
cellular response to interleukin-6Transcription factor p65Homo sapiens (human)
cellular response to tumor necrosis factorTranscription factor p65Homo sapiens (human)
postsynapse to nucleus signaling pathwayTranscription factor p65Homo sapiens (human)
antiviral innate immune responseTranscription factor p65Homo sapiens (human)
negative regulation of non-canonical NF-kappaB signal transductionTranscription factor p65Homo sapiens (human)
positive regulation of non-canonical NF-kappaB signal transductionTranscription factor p65Homo sapiens (human)
negative regulation of miRNA transcriptionTranscription factor p65Homo sapiens (human)
positive regulation of miRNA transcriptionTranscription factor p65Homo sapiens (human)
cellular response to angiotensinTranscription factor p65Homo sapiens (human)
positive regulation of leukocyte adhesion to vascular endothelial cellTranscription factor p65Homo sapiens (human)
positive regulation of miRNA metabolic processTranscription factor p65Homo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathwayTranscription factor p65Homo sapiens (human)
cellular response to stressTranscription factor p65Homo sapiens (human)
response to cytokineTranscription factor p65Homo sapiens (human)
innate immune responseTranscription factor p65Homo sapiens (human)
in utero embryonic developmentTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
heart morphogenesisTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
cardiac septum developmentTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
transforming growth factor beta receptor signaling pathwayTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
lung developmentTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
aorta developmentTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
non-canonical NF-kappaB signal transductionTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
positive regulation of MAPK cascadeTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
coronary vasculature developmentTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
positive regulation of protein serine/threonine kinase activityTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
positive regulation of cGAS/STING signaling pathwayTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
protein dephosphorylationTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
positive regulation of Notch signaling pathwayBMP-2-inducible protein kinaseHomo sapiens (human)
regulation of clathrin-dependent endocytosisBMP-2-inducible protein kinaseHomo sapiens (human)
regulation of bone mineralizationBMP-2-inducible protein kinaseHomo sapiens (human)
phospholipid metabolic processPhospholipase A-2-activating proteinHomo sapiens (human)
prostaglandin metabolic processPhospholipase A-2-activating proteinHomo sapiens (human)
inflammatory responsePhospholipase A-2-activating proteinHomo sapiens (human)
signal transductionPhospholipase A-2-activating proteinHomo sapiens (human)
nervous system developmentPhospholipase A-2-activating proteinHomo sapiens (human)
macroautophagyPhospholipase A-2-activating proteinHomo sapiens (human)
positive regulation of phospholipase A2 activityPhospholipase A-2-activating proteinHomo sapiens (human)
ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathwayPhospholipase A-2-activating proteinHomo sapiens (human)
cellular response to lipopolysaccharidePhospholipase A-2-activating proteinHomo sapiens (human)
negative regulation of protein K63-linked ubiquitinationPhospholipase A-2-activating proteinHomo sapiens (human)
positive regulation of synaptic vesicle recyclingPhospholipase A-2-activating proteinHomo sapiens (human)
positive regulation of dendrite extensionPhospholipase A-2-activating proteinHomo sapiens (human)
positive regulation of neuron migrationPhospholipase A-2-activating proteinHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processPhospholipase A-2-activating proteinHomo sapiens (human)
ubiquitin recyclingPhospholipase A-2-activating proteinHomo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Molecular Functions (64)

Processvia Protein(s)Taxonomy
magnesium ion bindingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
MAP kinase activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
MAP kinase kinase activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
JUN kinase kinase activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
enzyme bindingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
protein kinase bindingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
protein phosphatase bindingDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
molecular function activator activityDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
magnesium ion bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
transcription coactivator bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
type II transforming growth factor beta receptor bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
MAP kinase kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
receptor tyrosine kinase bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
ubiquitin protein ligase bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
histone kinase activityMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
identical protein bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
scaffold protein bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
protein serine/threonine kinase bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
DNA-binding transcription factor bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
linear polyubiquitin bindingMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
phosphotyrosine residue bindingMitogen-activated protein kinase 1Homo sapiens (human)
DNA bindingMitogen-activated protein kinase 1Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
MAP kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
protein bindingMitogen-activated protein kinase 1Homo sapiens (human)
ATP bindingMitogen-activated protein kinase 1Homo sapiens (human)
RNA polymerase II CTD heptapeptide repeat kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
phosphatase bindingMitogen-activated protein kinase 1Homo sapiens (human)
identical protein bindingMitogen-activated protein kinase 1Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase 1Homo sapiens (human)
protein kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
JUN kinase kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
molecular adaptor activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
RNA polymerase II transcription regulatory region sequence-specific DNA bindingNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
RNA polymerase II cis-regulatory region sequence-specific DNA bindingNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
DNA-binding transcription factor activity, RNA polymerase II-specificNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
DNA-binding transcription activator activity, RNA polymerase II-specificNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
DNA-binding transcription factor activityNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
protein bindingNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
zinc ion bindingNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
sequence-specific DNA bindingNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
sequence-specific double-stranded DNA bindingNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
nuclear receptor activityNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
protein kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine/threonine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
MAP kinase kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine/threonine/tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein tyrosine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
MAP-kinase scaffold activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein bindingDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
ATP bindingDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein kinase activator activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine/threonine kinase activator activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
scaffold protein bindingDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
protein serine kinase activityDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
transcription cis-regulatory region bindingTranscription factor p65Homo sapiens (human)
RNA polymerase II transcription regulatory region sequence-specific DNA bindingTranscription factor p65Homo sapiens (human)
RNA polymerase II cis-regulatory region sequence-specific DNA bindingTranscription factor p65Homo sapiens (human)
RNA polymerase II core promoter sequence-specific DNA bindingTranscription factor p65Homo sapiens (human)
DNA-binding transcription factor activity, RNA polymerase II-specificTranscription factor p65Homo sapiens (human)
transcription coactivator bindingTranscription factor p65Homo sapiens (human)
DNA-binding transcription repressor activity, RNA polymerase II-specificTranscription factor p65Homo sapiens (human)
DNA-binding transcription activator activity, RNA polymerase II-specificTranscription factor p65Homo sapiens (human)
DNA bindingTranscription factor p65Homo sapiens (human)
chromatin bindingTranscription factor p65Homo sapiens (human)
DNA-binding transcription factor activityTranscription factor p65Homo sapiens (human)
protein bindingTranscription factor p65Homo sapiens (human)
enzyme bindingTranscription factor p65Homo sapiens (human)
protein kinase bindingTranscription factor p65Homo sapiens (human)
chromatin DNA bindingTranscription factor p65Homo sapiens (human)
ubiquitin protein ligase bindingTranscription factor p65Homo sapiens (human)
peptide bindingTranscription factor p65Homo sapiens (human)
phosphate ion bindingTranscription factor p65Homo sapiens (human)
identical protein bindingTranscription factor p65Homo sapiens (human)
protein homodimerization activityTranscription factor p65Homo sapiens (human)
actinin bindingTranscription factor p65Homo sapiens (human)
histone deacetylase bindingTranscription factor p65Homo sapiens (human)
NF-kappaB bindingTranscription factor p65Homo sapiens (human)
ankyrin repeat bindingTranscription factor p65Homo sapiens (human)
general transcription initiation factor bindingTranscription factor p65Homo sapiens (human)
DNA-binding transcription factor bindingTranscription factor p65Homo sapiens (human)
protein serine/threonine phosphatase activityTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
protein bindingTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
protein serine/threonine kinase activator activityTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
protein-containing complex bindingTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
mitogen-activated protein kinase p38 bindingTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
molecular adaptor activityTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
protein bindingBMP-2-inducible protein kinaseHomo sapiens (human)
ATP bindingBMP-2-inducible protein kinaseHomo sapiens (human)
protein serine kinase activityBMP-2-inducible protein kinaseHomo sapiens (human)
phosphatase regulator activityBMP-2-inducible protein kinaseHomo sapiens (human)
AP-2 adaptor complex bindingBMP-2-inducible protein kinaseHomo sapiens (human)
protein serine/threonine kinase activityBMP-2-inducible protein kinaseHomo sapiens (human)
protein bindingPhospholipase A-2-activating proteinHomo sapiens (human)
phospholipase A2 activator activityPhospholipase A-2-activating proteinHomo sapiens (human)
ubiquitin bindingPhospholipase A-2-activating proteinHomo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Ceullar Components (36)

Processvia Protein(s)Taxonomy
nucleusDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
cytoplasmDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 7Homo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
nucleusMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
plasma membraneMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
endosome membraneMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
ATAC complexMitogen-activated protein kinase kinase kinase 7Homo sapiens (human)
extracellular regionMitogen-activated protein kinase 1Homo sapiens (human)
nucleusMitogen-activated protein kinase 1Homo sapiens (human)
nucleoplasmMitogen-activated protein kinase 1Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 1Homo sapiens (human)
mitochondrionMitogen-activated protein kinase 1Homo sapiens (human)
early endosomeMitogen-activated protein kinase 1Homo sapiens (human)
late endosomeMitogen-activated protein kinase 1Homo sapiens (human)
endoplasmic reticulum lumenMitogen-activated protein kinase 1Homo sapiens (human)
Golgi apparatusMitogen-activated protein kinase 1Homo sapiens (human)
centrosomeMitogen-activated protein kinase 1Homo sapiens (human)
cytosolMitogen-activated protein kinase 1Homo sapiens (human)
cytoskeletonMitogen-activated protein kinase 1Homo sapiens (human)
plasma membraneMitogen-activated protein kinase 1Homo sapiens (human)
caveolaMitogen-activated protein kinase 1Homo sapiens (human)
focal adhesionMitogen-activated protein kinase 1Homo sapiens (human)
pseudopodiumMitogen-activated protein kinase 1Homo sapiens (human)
azurophil granule lumenMitogen-activated protein kinase 1Homo sapiens (human)
synapseMitogen-activated protein kinase 1Homo sapiens (human)
mitotic spindleMitogen-activated protein kinase 1Homo sapiens (human)
ficolin-1-rich granule lumenMitogen-activated protein kinase 1Homo sapiens (human)
cytoplasmMitogen-activated protein kinase 1Homo sapiens (human)
nucleusMitogen-activated protein kinase 1Homo sapiens (human)
nucleusDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
axonDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
dendrite cytoplasmDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
perikaryonDual specificity mitogen-activated protein kinase kinase 4Homo sapiens (human)
nucleoplasmNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
chromatinNuclear receptor subfamily 2 group C member 2Homo sapiens (human)
nucleusDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
mitochondrionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
early endosomeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
late endosomeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
endoplasmic reticulumDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
Golgi apparatusDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
centrosomeDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
cytosolDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
plasma membraneDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
focal adhesionDual specificity mitogen-activated protein kinase kinase 1Homo sapiens (human)
nucleolusTranscription factor p65Homo sapiens (human)
nucleusTranscription factor p65Homo sapiens (human)
glutamatergic synapseTranscription factor p65Homo sapiens (human)
nucleusTranscription factor p65Homo sapiens (human)
nucleoplasmTranscription factor p65Homo sapiens (human)
cytoplasmTranscription factor p65Homo sapiens (human)
cytosolTranscription factor p65Homo sapiens (human)
NF-kappaB p50/p65 complexTranscription factor p65Homo sapiens (human)
NF-kappaB complexTranscription factor p65Homo sapiens (human)
chromatinTranscription factor p65Homo sapiens (human)
transcription regulator complexTranscription factor p65Homo sapiens (human)
cytoplasmTranscription factor p65Homo sapiens (human)
cytoplasmTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
endoplasmic reticulumTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
endoplasmic reticulum membraneTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
cytosolTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
endosome membraneTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
nuclear speckTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
protein-containing complexTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
cytosolTGF-beta-activated kinase 1 and MAP3K7-binding protein 1Homo sapiens (human)
nuclear speckBMP-2-inducible protein kinaseHomo sapiens (human)
cytoplasmBMP-2-inducible protein kinaseHomo sapiens (human)
nucleusBMP-2-inducible protein kinaseHomo sapiens (human)
nucleusPhospholipase A-2-activating proteinHomo sapiens (human)
cytoplasmPhospholipase A-2-activating proteinHomo sapiens (human)
synapsePhospholipase A-2-activating proteinHomo sapiens (human)
extracellular exosomePhospholipase A-2-activating proteinHomo sapiens (human)
cytoplasmPhospholipase A-2-activating proteinHomo sapiens (human)
nucleusPhospholipase A-2-activating proteinHomo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Bioassays (327)

Assay IDTitleYearJournalArticle
AID686947qHTS for small molecule inhibitors of Yes1 kinase: Primary Screen2013Bioorganic & medicinal chemistry letters, Aug-01, Volume: 23, Issue:15
Identification of potent Yes1 kinase inhibitors using a library screening approach.
AID1346987P-glycoprotein substrates identified in KB-8-5-11 adenocarcinoma cell line, qHTS therapeutic library screen2019Molecular pharmacology, 11, Volume: 96, Issue:5
A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein.
AID1346986P-glycoprotein substrates identified in KB-3-1 adenocarcinoma cell line, qHTS therapeutic library screen2019Molecular pharmacology, 11, Volume: 96, Issue:5
A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein.
AID1345781Human mitogen-activated protein kinase kinase kinase 7 (TAK1 subfamily)2012Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
Irreversible protein kinase inhibitors: balancing the benefits and risks.
AID1345781Human mitogen-activated protein kinase kinase kinase 7 (TAK1 subfamily)2013ACS chemical biology, Mar-15, Volume: 8, Issue:3
Mechanism and in vitro pharmacology of TAK1 inhibition by (5Z)-7-Oxozeaenol.
AID1490268Inhibition of YANK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPDNILLDER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1176814Inhibition of ERK2 (unknown origin) using FITC-labeled substrate peptide assessed as phosphorylation2015Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner.
AID1490096Inhibition of CDK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNILVTSSGQIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490071Inhibition of AurA in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPENLLLGSAGELK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1772487Inhibition of Tak1/Tab1 (unknown origin) assessed as inhibition of Tak1 kinase activity preincubated for 30 mins followed by addition of MBP protein and ATP and measured after 2 hrs by ADP-Glo kinase assay2021European journal of medicinal chemistry, Nov-05, Volume: 223Design, synthesis, docking, molecular dynamics and bioevaluation studies on novel N-methylpicolinamide and thienopyrimidine derivatives with inhibiting NF-κB and TAK1 activities: Cheminformatics tools RDKit applied in drug design.
AID1709628Cytotoxicity against TNFalpha-induced human HCT-15 cells assessed as reduction in cell viability preincubated for 2 hrs followed by TNFalpha stimulation and measured after 72 hrs by celltiter-glo assay2021ACS medicinal chemistry letters, Apr-08, Volume: 12, Issue:4
Discovery of 2,4-1
AID1490314Antiproliferative activity against human NCI-H23 cells harboring KRAS G12C mutant after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490850Inhibition of human FLT3 (592 to 969 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490107Inhibition of EGFR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IPVAIKELR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490114Inhibition of FES in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LRADNTLVAVKSCR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490210Inhibition of p70S6K in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIMLNHQGHVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490846Inhibition of human MEK5 (98 to 448 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490209Inhibition of p38g in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPGNLAVNEDCELK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490200Inhibition of NEK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPANVFITATGVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490072Inhibition of AurA in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GKFGNVYLAR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490193Inhibition of YSK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAANVLLSEQGDVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1336654Inhibition of full length recombinant human GST-tagged ERK2 expressed in Escherichia coli using Ser/Thr 03 as substrate after 1 hr by Z'-Lyte assay2017Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
Structure-guided development of covalent TAK1 inhibitors.
AID1876268Binding affinity to BIKE (unknown origin) assessed as dissociation constant2022Journal of medicinal chemistry, 01-27, Volume: 65, Issue:2
Kinase Inhibitors as Underexplored Antiviral Agents.
AID1490214Inhibition of PCTAIRE1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKLTDNLVALKEIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490269Inhibition of ZAK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled WISQDKEVAVKK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490146Inhibition of KHS1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NVHTGELAAVKIIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490162Inhibition of MAP2K4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPSNILLDR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490093Inhibition of CDK8 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANILVMGEGPER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490279Inhibition of human FLT4 (821 to 1196 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490154Inhibition of LOK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAGNVLMTLEGDIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490174Inhibition of MARK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAVKIIDK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490235Inhibition of RAF1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DMKSNNIFLHEGLTVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490216Inhibition of PCTAIRE3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490281Inhibition of human FLT1 (781 to 1239 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490832Inhibition of TAK1 in RA patient-derived synovial fibroblasts assessed as inhibition of IL-1alpha-induced cytokine secretion at 0.6 uM preincubated for 3 hrs followed by IL-1alpha stimulation measured after 18 hrs by sandwich immunoassay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID470679Normalised AUC in BALB/c mouse at 3 mg/kg, iv2009Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead.
AID1490254Inhibition of TAO3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLTEPGQVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID606027Antimicrobial activity against Staphylococcus aureus by agar plate diffusion assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID1490198Inhibition of NEK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TVALKK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490091Inhibition of CDC2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLIDDK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1254043Inhibition of TAK1 (unknown origin)2015Bioorganic & medicinal chemistry, Nov-01, Volume: 23, Issue:21
Isolation, semisynthesis, covalent docking and transforming growth factor beta-activated kinase 1 (TAK1)-inhibitory activities of (5Z)-7-oxozeaenol analogues.
AID1490271Inhibition of ZC1/HGK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGQNVLLTENAEVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490133Inhibition of IKKb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIVLQQGEQR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490248Inhibition of SRPK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IIHTDIKPENILLSVNEQYIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490236Inhibition of RIPK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNVLLDPELHVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490177Inhibition of MARK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAENLLLDADMNIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490102Inhibition of CSK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VSDFGLTKEASSTQDTGKLPVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490245Inhibition of SGK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FYAVKVLQK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490296Inhibition of TAK1 (unknown origin) by LanthaScreen assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490173Inhibition of MARK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAVKIIDK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490167Inhibition of MAP3K15 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGDNVLVNTYSGVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1176813Inhibition of MAP2K1 (unknown origin) using unphosphorylated GST-tagged ERK2 substrate protein assessed as phosphorylation by ELISA2015Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner.
AID1490205Inhibition of OSR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKAGNILLGEDGSVQIADFGVSAFLATGGDITR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490079Inhibition of BRAF in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSNNIFLHEDLTVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490066Inhibition of AMPKa2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENVLLDAHMNAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490219Inhibition of PEK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIFFTMDDVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490126Inhibition of GCN2 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPVNIFLDSDDHVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490838Increase in secretion of basic-FGF in IL-1alpha activated RA patient-derived synovial fibroblasts at 0.6 to 3 uM preincubated for 3 hrs followed by IL-1alpha stimulation measured after 18 hrs by sandwich immunoassay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490139Inhibition of IRE1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPHNILISMPNAHGK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490849Inhibition of human FLT1 (781 to 1239 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490100Inhibition of CHK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENVLLSSQEEDCLIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490207Inhibition of p38a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QELNKTIWEVPER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490309Antiproliferative activity against human SW156 cells harboring wild type KRAS after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490099Inhibition of CHK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPENLLLDER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490241Inhibition of RSK3 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENILLDEEGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490122Inhibition of FYN in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QGAKFPIKWTAPEAALYGR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490164Inhibition of MAP2K6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNVLINALGQVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490847Inhibition of human FLT4 (821 to 1196 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490292Inhibition of human TAK1 (1 to 303 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490132Inhibition of IKKa in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIVLQDVGGK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490307Antiproliferative activity against human PANC1 cells harboring KRAS G12D mutant after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490184Inhibition of MLKL in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled APVAIKVFK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490266Inhibition of Wnk2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKCDNIFITGPTGSVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490208Inhibition of p38d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPGNLAVNEDCELK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490291Inhibition of human RSK4 (1 to 397 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490282Inhibition of human FLT3 (592 to 969 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490165Inhibition of MAP2K7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNILLDER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490226Inhibition of PIP4K2C in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TLVIKEVSSEDIADMHSNLSNYHQYIVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490104Inhibition of DNAPK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled KGGSWIQEINVAEK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID470414Volume of distribution at steady state in BALB/c mouse at 3 mg/kg, iv2009Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead.
AID1490074Inhibition of AurC in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GKFGNVYLAR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490129Inhibition of HER2/ErbB2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GIWIPDGENVKIPVAIKVLR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490258Inhibition of TLK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YLNEIKPPIIHYDLKPGNILLVNGTACEIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490152Inhibition of LCK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EGAKFPIKWTAPEAINYGTFTIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490111Inhibition of Erk2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLLLNTTCDLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490097Inhibition of CDK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPNNLLLDENGVLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID719897Inhibition of Erk22012Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
Irreversible protein kinase inhibitors: balancing the benefits and risks.
AID1490085Inhibition of CaMK2g in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490160Inhibition of MAP2K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNILVNSR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID470413Clearance in BALB/c mouse at 3 mg/kg, iv2009Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead.
AID1490070Inhibition of AurA in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FILALKVLFK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1311909Inhibition of full length TAK1 (unknown origin) fused with TAB1 using biotin-MKK6 as substrate by AlphaScreen assay2016Bioorganic & medicinal chemistry, 09-15, Volume: 24, Issue:18
Discovery of a potent and highly selective transforming growth factor β receptor-associated kinase 1 (TAK1) inhibitor by structure based drug design (SBDD).
AID1490159Inhibition of MAP2K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNILVNSR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490170Inhibition of MAP3K3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANILR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490238Inhibition of RSK1 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LTDFGLSKEAIDHEKK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID589426Competitive inhibition of recombinant TAK1-TAB1 assessed as [33P]gamma-ATP incorporation into substrate histone H1 peptide by filter plate assay2011Bioorganic & medicinal chemistry letters, Mar-15, Volume: 21, Issue:6
Oxindole derivatives as inhibitors of TAK1 kinase.
AID1490305Antiproliferative activity against human SW620 cells harboring KRAS G12V mutant after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490839Increase in secretion of basic-FGF in poly(I:C) activated RA patient-derived synovial fibroblasts at 0.6 to 3 uM preincubated for 3 hrs followed by poly(I:C) stimulation measured after 18 hrs by sandwich immunoassay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490294Inhibition of human VEGFR2 (787 to 1253 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490080Inhibition of CaMK1a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LVAIKCIAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490837Increase in secretion of basic-FGF in TNFalpha activated RA patient-derived synovial fibroblasts at 0.6 to 3 uM preincubated for 3 hrs followed by TNFalpha stimulation measured after 18 hrs by sandwich immunoassay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490267Inhibition of Wnk3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKCDNIFITGPTGSVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490191Inhibition of MST3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAANVLLSEHGEVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID719898Inhibition of MEK12012Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
Irreversible protein kinase inhibitors: balancing the benefits and risks.
AID1490252Inhibition of TAK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPPNLLLVAGGTVLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1254042Inhibition of TAK1 (unknown origin) expressed in sf9 cells assessed as 32P level incorporation into myelin basic protein incubated for 5 mins at 30 degC by immunoprecipitation method2015Bioorganic & medicinal chemistry, Nov-01, Volume: 23, Issue:21
Isolation, semisynthesis, covalent docking and transforming growth factor beta-activated kinase 1 (TAK1)-inhibitory activities of (5Z)-7-oxozeaenol analogues.
AID480394Antiinflammatory activity in iv dosed mouse assessed as inhibition of LPS-stimulated TNFalpha production2010Bioorganic & medicinal chemistry letters, May-15, Volume: 20, Issue:10
Discovery of an in vitro and in vivo potent resorcylic lactone analog of LL-Z1640-2 as anti-inflammatory lead, II.
AID1490227Inhibition of PIP5K3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GGKSGAAFYATEDDRFILK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490192Inhibition of MST4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAANVLLSEQGDVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490275Inhibition of full length human MEK1 (1 to 393 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490194Inhibition of NDR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNLLLDSK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490127Inhibition of GSK3A in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPQNLLVDPDTAVLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490069Inhibition of ATR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FYIMMCKPK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490084Inhibition of CaMK2d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490276Inhibition of full length human MEK2 (1 to 400 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490128Inhibition of GSK3B in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPQNLLLDPDTAVLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490851Inhibition of human KIT (571 to 952 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490082Inhibition of CaMK2a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490854Inhibition of full length human MEK3 (1 to 318 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490075Inhibition of AurB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SHFIVALKVLFK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490204Inhibition of NuaK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LVAIKSIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1176815Inhibition of TAK1 (unknown origin) using unphosphorylated GST-tagged MAP2K7 substrate protein assessed as phosphorylation by ELISA2015Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner.
AID1336665Inhibition of human TAK1 (M1 to Q303 residues) expressed in mammalian expression system at 10 uM by KINOMEScan assay2017Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
Structure-guided development of covalent TAK1 inhibitors.
AID1490289Inhibition of human ZAK (1 to 331 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490298Antiproliferative activity against mouse BA/F3 cells harboring KRAS G12D mutant after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490239Inhibition of RSK1 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENILLDEEGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490134Inhibition of IKKe in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPGNIMR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID470411Antiinflammatory activity in human THP1 cells assessed as inhibition of LPS-induced TNFalpha production by PLAP reporter assay2009Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead.
AID1490280Inhibition of human MEK4 (84 to 399 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490842Inhibition of full length human RIOK3 (1 to 519 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490852Inhibition of human TGFBR2 (218 to 567 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490197Inhibition of NEK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKTQNVFLTR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490290Inhibition of human PRKD2 (519 to 838 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490110Inhibition of Erk1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLLINTTCDLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490171Inhibition of MAP3K4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANIFLTSSGLIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490199Inhibition of NEK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPANVFITATGVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID606022Cytotoxicity against human MCF7 cells after 72 hrs by MTS assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID553212Metabolic stability in mouse blood assessed as compound conversion to metabolite C7'-C8' E isomer2011ACS medicinal chemistry letters, Jan-13, Volume: 2, Issue:1
Kinase inhibition by deoxy analogues of the resorcylic lactone L-783277.
AID470412Antiinflammatory activity in human B164 cells assessed as inhibition of LPS-induced Actin production by PLAP reporter assay2009Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead.
AID1490316Antiproliferative activity against human NCI-H23 cells harboring KRAS G12C mutant at2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490844Inhibition of full length human MEK2 (1 to 400 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490117Inhibition of PDGFRb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490185Inhibition of MRCKb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNVLLDVNGHIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490131Inhibition of HPK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANILINDAGEVR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490242Inhibition of RSK1 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNILYVDESGNPECLR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490135Inhibition of TBK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPGNIMR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490274Inhibition of full length human RIOK3 (1 to 519 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490083Inhibition of CaMK2b in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490293Inhibition of human BIKE (34 to 329 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490155Inhibition of LYN in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKTLKPGTMSVQAFLEEANLMK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490081Inhibition of CaMK1d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LFAVKCIPK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490853Inhibition of human STK36 (1 to 271 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1336664Inhibition of human TAK1 (M1 to Q303 residues) expressed in mammalian expression system at 1 uM by KINOMEScan assay2017Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
Structure-guided development of covalent TAK1 inhibitors.
AID1469808Inhibition of TNFalpha-PLAP (unknown origin)2017Journal of medicinal chemistry, 02-09, Volume: 60, Issue:3
Covalent Modifiers: A Chemical Perspective on the Reactivity of α,β-Unsaturated Carbonyls with Thiols via Hetero-Michael Addition Reactions.
AID606026Antimicrobial activity against Escherichia coli by agar plate diffusion assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID1490182Inhibition of MLK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSNNILLLQPIESDDMEHK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490220Inhibition of PFTAIRE2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLISHLGELK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490153Inhibition of LKB1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPGNLLLTTGGTLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490221Inhibition of PI4KB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VPHTQAVVLNSKDK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490283Inhibition of human KIT (571 to 952 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490113Inhibition of FER in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TSVAVKTCKEDLPQELK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490222Inhibition of PIK3C2B in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VIFKCGDDLRQDMLTLQMIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490145Inhibition of JNK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490065Inhibition of AMPKa1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENVLLDAHMNAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490137Inhibition of IRAK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled AIQFLHQDSPSLIHGDIKSSNVLLDER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490087Inhibition of CaMK2g in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TSTQEYAAKIINTK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490250Inhibition of STLK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SIKASHILISGDGLVTLSGLSHLHSLV probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490095Inhibition of CDK5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490073Inhibition of AurB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GKFGNVYLAR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490195Inhibition of NDR2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNLLLDAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490108Inhibition of EphA2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VLEDDPEATYTTSGGKIPIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID553123Metabolic stability in mouse plasma assessed as compound conversion to metabolite C7'-C8' E isomer2011ACS medicinal chemistry letters, Jan-13, Volume: 2, Issue:1
Kinase inhibition by deoxy analogues of the resorcylic lactone L-783277.
AID1490243Inhibition of RSK2 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNILYVDESGNPESIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490112Inhibition of Erk5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLLVNENCELK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID719900Inhibition of MKK42012Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
Irreversible protein kinase inhibitors: balancing the benefits and risks.
AID606021Cytotoxicity against human HT-29 cells after 72 hrs by MTS assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID1490156Inhibition of MAP2K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IMHRDVKPSNILVNSR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490098Inhibition of CHED in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKCSNILLNNR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490140Inhibition of IRE2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPGNILITGPDSQGLGR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490181Inhibition of MET in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TGAKLPVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490090Inhibition of CCRK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANLLISASGQLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490860Inhibition of human TAK1 (1 to 303 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490295Inhibition of human CDKL2 (1 to 327 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490088Inhibition of CaMK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLYATPAPDAPLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490862Inhibition of human VEGFR2 (787 to 1253 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490176Inhibition of MARK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAENLLLDADMNIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490224Inhibition of PIK3CB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VFGEDSVGVIFKNGDDLRQDMLTLQMLR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490233Inhibition of PRP4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled CNILHADIKPDNILVNESK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490212Inhibition of PAK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IGQGASGTVFTATDVALGQEVAIKQINLQK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490310Antiproliferative activity against human URMC6 cells harboring wild type KRAS after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490189Inhibition of MST2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLNTEGHAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490123Inhibition of SRC in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QGAKFPIKWTAPEAALYGR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490863Inhibition of human CDKL2 (1 to 327 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID606028Antimicrobial activity against Mycobacterium smegmatis by agar plate diffusion assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID606029Antimicrobial activity against Bacillus subtilis by agar plate diffusion assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID1490190Inhibition of MST2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ESGQVVAIKQVPVESDLQEIIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490273Inhibition of ZC3/MINK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGQNVLLTENAEVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490068Inhibition of ARAF in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSNNIFLHEGLTVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490848Inhibition of human MEK4 (84 to 399 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490180Inhibition of MASTL in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LYAVKVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490211Inhibition of p70S6Kb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIMLSSQGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490278Inhibition of human MEK5 (98 to 448 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490178Inhibition of MARK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAIKIIDKTQLNPTSLQK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490308Antiproliferative activity against human AsPC1 cells harboring KRAS G12D mutant after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490092Inhibition of CDK11 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANILVMGEGPER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490858Inhibition of human PRKD2 (519 to 838 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490270Inhibition of ZAP70 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ISDFGLSKALGADDSYYTAR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490105Inhibition of eEF2K in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YIKYNSNSGFVR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490272Inhibition of ZC2/TNIK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGQNVLLTENAEVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490183Inhibition of MLK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSSNILLLEK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490218Inhibition of PCTAIRE3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKLTENLVALKEIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490106Inhibition of EGFR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LLGAEEKEYHAEGGKVPIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490203Inhibition of NEK9 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKTLNIFLTK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID470678Half life in BALB/c mouse at 3 mg/kg, iv2009Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead.
AID1490161Inhibition of MAP2K3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNVLINK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490213Inhibition of PAN3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VMDPTKILITGK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1336652Inhibition of full length recombinant human GST-tagged TAK1 expressed in baculovirus expression system after 1 hr by TR-FRET based LanthaScreen assay2017Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
Structure-guided development of covalent TAK1 inhibitors.
AID1490141Inhibition of JAK1 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QLASALSYLEDKDLVHGNVCTKNLLLAR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490859Inhibition of human RSK4 (1 to 397 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490188Inhibition of MST1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLNTEGHAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490130Inhibition of HER3/ErbB3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GVWIPEGESIKIPVCIKVIEDK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID606031Inhibition of NFkappa p65 isolated from nuclear extract of human HeLa cells by ELISA2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID1490119Inhibition of FRAP in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IQSIAPSLQVITSKQRPR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1336653Inhibition of full length recombinant human His-tagged MEK1 expressed in baculovirus expression system after 1 hr by TR-FRET based LanthaScreen assay2017Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
Structure-guided development of covalent TAK1 inhibitors.
AID1490086Inhibition of CaMK2d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IPTGQEYAAKIINTKK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490317Antiproliferative activity against human NCI-H358 cells harboring KRAS G12C mutant at2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490149Inhibition of KSR2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKNVFYDNGK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1772488Inhibition of NF-kB (unknown origin) expressed in HEK293T cells transfected with pTK-Renilla reporter preincubated for 6 hrs followed by addition of TNF-alpha and measured after 8 hrs by Dual luciferase reporter assay2021European journal of medicinal chemistry, Nov-05, Volume: 223Design, synthesis, docking, molecular dynamics and bioevaluation studies on novel N-methylpicolinamide and thienopyrimidine derivatives with inhibiting NF-κB and TAK1 activities: Cheminformatics tools RDKit applied in drug design.
AID1490163Inhibition of MAP2K5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNMLVNTR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490187Inhibition of MST1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ETGQIVAIKQVPVESDLQEIIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490246Inhibition of SLK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAGNILFTLDGDIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID606024Cytotoxicity against human SF268 cells after 72 hrs by MTS assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID1490234Inhibition of PRPK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FLSGLELVKQGAEAR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490109Inhibition of EphB2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FLEDDTSDPTYTSALGGKIPIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490147Inhibition of KHS2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NVNTGELAAIKVIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490259Inhibition of TNK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SVPVAVKSLR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490172Inhibition of MAP3K5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGDNVLINTYSGVLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490299Antiproliferative activity against mouse BA/F3 cells harboring KRAS G12D mutant after 72 hrs in presence of IL-3 by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1176812Inhibition of MAP2K7 (unknown origin) using unphosphorylated GST-tagged JNK1 substrate protein assessed as phosphorylation by ELISA2015Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner.
AID1490064Inhibition of ACK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TVSVAVKCLKPDVLSQPEAMDDFIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490857Inhibition of human ZAK (1 to 331 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID553213Metabolic stability in human plasma assessed as compound conversion to metabolite C7'-C8' E isomer at 55 uM after 20 mins at 37 degC2011ACS medicinal chemistry letters, Jan-13, Volume: 2, Issue:1
Kinase inhibition by deoxy analogues of the resorcylic lactone L-783277.
AID1490260Inhibition of TTK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NMLEAVHTIHQHGIVHSDLKPANFLIDGMLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490256Inhibition of TBK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TGDLFAIKVFNNISFLRPVDVQMR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1613078Inhibition of full length TAK1/TAB1 (unknown origin) using biotin-MKK6 as substrate by AlphaScreen assay2019European journal of medicinal chemistry, Feb-01, Volume: 163Synthesis and anti-tumor activity of imidazopyrazines as TAK1 inhibitors.
AID1490251Inhibition of SYK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ISDFGLSKALR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490120Inhibition of FRK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled HEIKLPVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490148Inhibition of KSR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKNVFYDNGK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490833Inhibition of TAK1 in RA patient-derived synovial fibroblasts assessed as inhibition of poly(I:C)-induced cytokine secretion at 0.6 uM preincubated for 3 hrs followed by poly(I:C) stimulation measured after 18 hrs by sandwich immunoassay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490217Inhibition of PCTAIRE2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKLTENLVALKEIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490264Inhibition of Wee1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YIHSMSLVHMDIKPSNIFISR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490158Inhibition of MAP2K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled KLIHLEIKPAIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490306Antiproliferative activity against human SKCO1 cells harboring KRAS G12V mutant after 72 hrs by CellTiter-Glo assay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490157Inhibition of MAP2K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled KLIHLEIKPAIR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490287Inhibition of human PDGFRA (575 to 1002 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490186Inhibition of MSK2 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKLENVLLDSEGHIVLTDFGLSK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490136Inhibition of ILK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled WQGNDIVVKVLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490845Inhibition of human PDGFRB (582 to 1009 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490196Inhibition of NEK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKSQNIFLTK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490168Inhibition of MAP3K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ELAVKQVQFDPDSPETSKEVNALECEQLLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490232Inhibition of PLK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled CFEISDADTKEVFAGKIVPK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490124Inhibition of YES in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QGAKFPIKWTAPEAALYGR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490247Inhibition of SMG1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DTVTIHSVGGTITILPTKTKPK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490265Inhibition of Wnk1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKCDNIFITGPTGSVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490151Inhibition of LATS2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNILIDLDGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490076Inhibition of AXL in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NCMLNENMSVCVADFGLSKK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490277Inhibition of human PDGFRB (582 to 1009 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490116Inhibition of FMS in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490861Inhibition of human BIKE (34 to 329 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490150Inhibition of LATS1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ALYATKTLR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490856Inhibition of human ACVR1 (188 to 509 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490118Inhibition of TYRO3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490237Inhibition of RON in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IQCAIKSLSR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490215Inhibition of PCTAIRE1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINER probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490230Inhibition of PKCz in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKLDNVLLDADGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490253Inhibition of TAO1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLTEPGQVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490231Inhibition of PKR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIFLVDTK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID719899Inhibition of MEK72012Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
Irreversible protein kinase inhibitors: balancing the benefits and risks.
AID1490179Inhibition of MAST3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPDNLLITSLGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490206Inhibition of p38a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLAVNEDCELK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID606025Cytotoxicity against human MDA-MB-435 cells after 72 hrs by MTS assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID1490249Inhibition of STLK5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YSVKVLPWLSPEVLQQNLQGYDAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490284Inhibition of human TGFBR2 (218 to 567 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490312Inhibition of biotin-labeled N-(2-(2-(2-(2-(4-(4-((4-((2-Acrylamidophenyl)amino)-5-chloropyrimidin-2-yl)amino)phenyl)piperazin-1-yl)ethoxy)ethoxy)ethoxy)ethyl)-5-((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanamide probe binding to TAK1 2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490078Inhibition of BMPR1A in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKNILIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490228Inhibition of PITSLRE in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKTSNLLLSHAGILK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490257Inhibition of TLK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YLNEIKPPIIHYDLKPGNILLVDGTACEIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID470680Metabolic stability in mouse plasma after 2 hrs2009Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead.
AID1490142Inhibition of JAK1 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IGDFGLTKAIETDKEYYTVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490121Inhibition of FYN in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAIKTLKPGTMSPESFLEEAQIMK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490286Inhibition of full length human MEK3 (1 to 318 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490255Inhibition of TAO2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKAGNILLSEPGLVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490244Inhibition of RSKL1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VLGVIDKVLLVMDTR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490138Inhibition of IRAK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKSANILLDEAFTAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490223Inhibition of PIK3C3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TEDGGKYPVIFKHGDDLRQDQLILQIISLMDK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490077Inhibition of BARK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANILLDEHGHVR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490166Inhibition of MAP3K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKGANLLIDSTGQR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490240Inhibition of RSK2 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENILLDEEGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490143Inhibition of JNK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490288Inhibition of human ACVR1 (188 to 509 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490831Inhibition of TAK1 in RA patient-derived synovial fibroblasts assessed as inhibition of TNFalpha-induced cytokine secretion at 0.6 uM preincubated for 3 hrs followed by TNFalpha stimulation measured after 18 hrs by sandwich immunoassay2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490229Inhibition of PKCi in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKLDNVLLDSEGHIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490855Inhibition of human PDGFRA (575 to 1002 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490094Inhibition of CDK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINTEGAIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID606023Cytotoxicity against human H460 cells after 72 hrs by MTS assay2011Journal of natural products, May-27, Volume: 74, Issue:5
Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships.
AID652590Inhibition of TAK-12011ACS medicinal chemistry letters, Sep-08, Volume: 2, Issue:9
Exploring aigialomycin d and its analogues as protein kinase inhibitors for cancer targets.
AID1490101Inhibition of CRK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKCSNILLNNSGQIK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490262Inhibition of ULK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNILLSYANR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1436865Binding affinity to recombinant human biotinylated N-terminal GST-tagged TAK1 (1 to 303 residues) fused with TAB1 (437 to 504 residues) expressed in baculovirus infected sf9 cells at 100 nM in presence of ATP by SPR assay2017Bioorganic & medicinal chemistry letters, 02-15, Volume: 27, Issue:4
Identification of a selective inhibitor of transforming growth factor β-activated kinase 1 by biosensor-based screening of focused libraries.
AID1490125Inhibition of GCK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANLLLTLQGDVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490225Inhibition of PIP4K2A in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled AKELPTLKDNDFINEGQK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490115Inhibition of FGFR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490067Inhibition of ANKRD3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TWLAIKCSPSLHVDDR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490261Inhibition of ULK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNILLSNPAGR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490285Inhibition of human STK36 (1 to 271 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490843Inhibition of full length human MEK1 (1 to 393 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490201Inhibition of NEK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled AACLLDGVPVALKK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490103Inhibition of DNAPK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EHPFLVKGGEDLR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490263Inhibition of VRK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled MLDVLEYIHENEYVHGDIKAANLLLYK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490175Inhibition of MARK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAVKIIDKTQLNSSSLQK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490202Inhibition of NEK8 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKTQNILLDK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490089Inhibition of CASK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ETGQQFAVKIVDVAK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490144Inhibition of JNK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIVVK probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1490169Inhibition of MAP3K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANILR probe by mass-spectrometric analysis relative to control2017Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors.
AID1296008Cytotoxic Profiling of Annotated Libraries Using Quantitative High-Throughput Screening2020SLAS discovery : advancing life sciences R & D, 01, Volume: 25, Issue:1
Cytotoxic Profiling of Annotated and Diverse Chemical Libraries Using Quantitative High-Throughput Screening.
AID1347160Primary screen NINDS Rhodamine qHTS for Zika virus inhibitors2020Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors.
AID1347159Primary screen GU Rhodamine qHTS for Zika virus inhibitors: Unlinked NS2B-NS3 protease assay2020Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors.
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023]

Research

Studies (23)

TimeframeStudies, This Drug (%)All Drugs %
pre-19900 (0.00)18.7374
1990's0 (0.00)18.2507
2000's1 (4.35)29.6817
2010's17 (73.91)24.3611
2020's5 (21.74)2.80
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Market Indicators

Research Demand Index: 12.46

According to the monthly volume, diversity, and competition of internet searches for this compound, as well the volume and growth of publications, there is estimated to be weak demand-to-supply ratio for research on this compound.

MetricThis Compound (vs All)
Research Demand Index12.46 (24.57)
Research Supply Index3.18 (2.92)
Research Growth Index5.64 (4.65)
Search Engine Demand Index0.00 (26.88)
Search Engine Supply Index0.00 (0.95)

This Compound (12.46)

All Compounds (24.57)

Study Types

Publication TypeThis drug (%)All Drugs (%)
Trials0 (0.00%)5.53%
Reviews2 (8.70%)6.00%
Case Studies0 (0.00%)4.05%
Observational0 (0.00%)0.25%
Other21 (91.30%)84.16%
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]
chemdatabank.com