AID686947 | qHTS for small molecule inhibitors of Yes1 kinase: Primary Screen | 2013 | Bioorganic & medicinal chemistry letters, Aug-01, Volume: 23, Issue:15
| Identification of potent Yes1 kinase inhibitors using a library screening approach. |
AID1346987 | P-glycoprotein substrates identified in KB-8-5-11 adenocarcinoma cell line, qHTS therapeutic library screen | 2019 | Molecular pharmacology, 11, Volume: 96, Issue:5
| A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein. |
AID1346986 | P-glycoprotein substrates identified in KB-3-1 adenocarcinoma cell line, qHTS therapeutic library screen | 2019 | Molecular pharmacology, 11, Volume: 96, Issue:5
| A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein. |
AID1345781 | Human mitogen-activated protein kinase kinase kinase 7 (TAK1 subfamily) | 2012 | Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
| Irreversible protein kinase inhibitors: balancing the benefits and risks. |
AID1345781 | Human mitogen-activated protein kinase kinase kinase 7 (TAK1 subfamily) | 2013 | ACS chemical biology, Mar-15, Volume: 8, Issue:3
| Mechanism and in vitro pharmacology of TAK1 inhibition by (5Z)-7-Oxozeaenol. |
AID1490268 | Inhibition of YANK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPDNILLDER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1176814 | Inhibition of ERK2 (unknown origin) using FITC-labeled substrate peptide assessed as phosphorylation | 2015 | Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
| 5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner. |
AID1490096 | Inhibition of CDK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNILVTSSGQIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490071 | Inhibition of AurA in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPENLLLGSAGELK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1772487 | Inhibition of Tak1/Tab1 (unknown origin) assessed as inhibition of Tak1 kinase activity preincubated for 30 mins followed by addition of MBP protein and ATP and measured after 2 hrs by ADP-Glo kinase assay | 2021 | European journal of medicinal chemistry, Nov-05, Volume: 223 | Design, synthesis, docking, molecular dynamics and bioevaluation studies on novel N-methylpicolinamide and thienopyrimidine derivatives with inhibiting NF-κB and TAK1 activities: Cheminformatics tools RDKit applied in drug design. |
AID1709628 | Cytotoxicity against TNFalpha-induced human HCT-15 cells assessed as reduction in cell viability preincubated for 2 hrs followed by TNFalpha stimulation and measured after 72 hrs by celltiter-glo assay | 2021 | ACS medicinal chemistry letters, Apr-08, Volume: 12, Issue:4
| Discovery of 2,4-1 |
AID1490314 | Antiproliferative activity against human NCI-H23 cells harboring KRAS G12C mutant after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490850 | Inhibition of human FLT3 (592 to 969 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490107 | Inhibition of EGFR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IPVAIKELR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490114 | Inhibition of FES in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LRADNTLVAVKSCR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490210 | Inhibition of p70S6K in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIMLNHQGHVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490846 | Inhibition of human MEK5 (98 to 448 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490209 | Inhibition of p38g in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPGNLAVNEDCELK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490200 | Inhibition of NEK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPANVFITATGVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490072 | Inhibition of AurA in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GKFGNVYLAR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490193 | Inhibition of YSK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAANVLLSEQGDVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1336654 | Inhibition of full length recombinant human GST-tagged ERK2 expressed in Escherichia coli using Ser/Thr 03 as substrate after 1 hr by Z'-Lyte assay | 2017 | Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
| Structure-guided development of covalent TAK1 inhibitors. |
AID1876268 | Binding affinity to BIKE (unknown origin) assessed as dissociation constant | 2022 | Journal of medicinal chemistry, 01-27, Volume: 65, Issue:2
| Kinase Inhibitors as Underexplored Antiviral Agents. |
AID1490214 | Inhibition of PCTAIRE1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKLTDNLVALKEIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490269 | Inhibition of ZAK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled WISQDKEVAVKK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490146 | Inhibition of KHS1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NVHTGELAAVKIIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490162 | Inhibition of MAP2K4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPSNILLDR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490093 | Inhibition of CDK8 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANILVMGEGPER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490279 | Inhibition of human FLT4 (821 to 1196 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490154 | Inhibition of LOK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAGNVLMTLEGDIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490174 | Inhibition of MARK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAVKIIDK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490235 | Inhibition of RAF1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DMKSNNIFLHEGLTVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490216 | Inhibition of PCTAIRE3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490281 | Inhibition of human FLT1 (781 to 1239 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490832 | Inhibition of TAK1 in RA patient-derived synovial fibroblasts assessed as inhibition of IL-1alpha-induced cytokine secretion at 0.6 uM preincubated for 3 hrs followed by IL-1alpha stimulation measured after 18 hrs by sandwich immunoassay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID470679 | Normalised AUC in BALB/c mouse at 3 mg/kg, iv | 2009 | Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
| Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead. |
AID1490254 | Inhibition of TAO3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLTEPGQVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID606027 | Antimicrobial activity against Staphylococcus aureus by agar plate diffusion assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID1490198 | Inhibition of NEK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TVALKK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490091 | Inhibition of CDC2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLIDDK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1254043 | Inhibition of TAK1 (unknown origin) | 2015 | Bioorganic & medicinal chemistry, Nov-01, Volume: 23, Issue:21
| Isolation, semisynthesis, covalent docking and transforming growth factor beta-activated kinase 1 (TAK1)-inhibitory activities of (5Z)-7-oxozeaenol analogues. |
AID1490271 | Inhibition of ZC1/HGK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGQNVLLTENAEVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490133 | Inhibition of IKKb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIVLQQGEQR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490248 | Inhibition of SRPK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IIHTDIKPENILLSVNEQYIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490236 | Inhibition of RIPK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNVLLDPELHVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490177 | Inhibition of MARK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAENLLLDADMNIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490102 | Inhibition of CSK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VSDFGLTKEASSTQDTGKLPVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490245 | Inhibition of SGK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FYAVKVLQK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490296 | Inhibition of TAK1 (unknown origin) by LanthaScreen assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490173 | Inhibition of MARK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAVKIIDK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490167 | Inhibition of MAP3K15 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGDNVLVNTYSGVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1176813 | Inhibition of MAP2K1 (unknown origin) using unphosphorylated GST-tagged ERK2 substrate protein assessed as phosphorylation by ELISA | 2015 | Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
| 5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner. |
AID1490205 | Inhibition of OSR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKAGNILLGEDGSVQIADFGVSAFLATGGDITR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490079 | Inhibition of BRAF in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSNNIFLHEDLTVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490066 | Inhibition of AMPKa2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENVLLDAHMNAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490219 | Inhibition of PEK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIFFTMDDVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490126 | Inhibition of GCN2 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPVNIFLDSDDHVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490838 | Increase in secretion of basic-FGF in IL-1alpha activated RA patient-derived synovial fibroblasts at 0.6 to 3 uM preincubated for 3 hrs followed by IL-1alpha stimulation measured after 18 hrs by sandwich immunoassay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490139 | Inhibition of IRE1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPHNILISMPNAHGK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490849 | Inhibition of human FLT1 (781 to 1239 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490100 | Inhibition of CHK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENVLLSSQEEDCLIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490207 | Inhibition of p38a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QELNKTIWEVPER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490309 | Antiproliferative activity against human SW156 cells harboring wild type KRAS after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490099 | Inhibition of CHK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPENLLLDER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490241 | Inhibition of RSK3 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENILLDEEGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490122 | Inhibition of FYN in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QGAKFPIKWTAPEAALYGR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490164 | Inhibition of MAP2K6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNVLINALGQVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490847 | Inhibition of human FLT4 (821 to 1196 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490292 | Inhibition of human TAK1 (1 to 303 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490132 | Inhibition of IKKa in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIVLQDVGGK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490307 | Antiproliferative activity against human PANC1 cells harboring KRAS G12D mutant after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490184 | Inhibition of MLKL in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled APVAIKVFK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490266 | Inhibition of Wnk2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKCDNIFITGPTGSVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490208 | Inhibition of p38d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPGNLAVNEDCELK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490291 | Inhibition of human RSK4 (1 to 397 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490282 | Inhibition of human FLT3 (592 to 969 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490165 | Inhibition of MAP2K7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNILLDER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490226 | Inhibition of PIP4K2C in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TLVIKEVSSEDIADMHSNLSNYHQYIVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490104 | Inhibition of DNAPK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled KGGSWIQEINVAEK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID470414 | Volume of distribution at steady state in BALB/c mouse at 3 mg/kg, iv | 2009 | Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
| Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead. |
AID1490074 | Inhibition of AurC in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GKFGNVYLAR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490129 | Inhibition of HER2/ErbB2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GIWIPDGENVKIPVAIKVLR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490258 | Inhibition of TLK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YLNEIKPPIIHYDLKPGNILLVNGTACEIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490152 | Inhibition of LCK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EGAKFPIKWTAPEAINYGTFTIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490111 | Inhibition of Erk2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLLLNTTCDLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490097 | Inhibition of CDK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPNNLLLDENGVLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID719897 | Inhibition of Erk2 | 2012 | Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
| Irreversible protein kinase inhibitors: balancing the benefits and risks. |
AID1490085 | Inhibition of CaMK2g in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490160 | Inhibition of MAP2K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNILVNSR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID470413 | Clearance in BALB/c mouse at 3 mg/kg, iv | 2009 | Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
| Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead. |
AID1490070 | Inhibition of AurA in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FILALKVLFK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1311909 | Inhibition of full length TAK1 (unknown origin) fused with TAB1 using biotin-MKK6 as substrate by AlphaScreen assay | 2016 | Bioorganic & medicinal chemistry, 09-15, Volume: 24, Issue:18
| Discovery of a potent and highly selective transforming growth factor β receptor-associated kinase 1 (TAK1) inhibitor by structure based drug design (SBDD). |
AID1490159 | Inhibition of MAP2K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNILVNSR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490170 | Inhibition of MAP3K3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANILR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490238 | Inhibition of RSK1 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LTDFGLSKEAIDHEKK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID589426 | Competitive inhibition of recombinant TAK1-TAB1 assessed as [33P]gamma-ATP incorporation into substrate histone H1 peptide by filter plate assay | 2011 | Bioorganic & medicinal chemistry letters, Mar-15, Volume: 21, Issue:6
| Oxindole derivatives as inhibitors of TAK1 kinase. |
AID1490305 | Antiproliferative activity against human SW620 cells harboring KRAS G12V mutant after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490839 | Increase in secretion of basic-FGF in poly(I:C) activated RA patient-derived synovial fibroblasts at 0.6 to 3 uM preincubated for 3 hrs followed by poly(I:C) stimulation measured after 18 hrs by sandwich immunoassay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490294 | Inhibition of human VEGFR2 (787 to 1253 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490080 | Inhibition of CaMK1a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LVAIKCIAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490837 | Increase in secretion of basic-FGF in TNFalpha activated RA patient-derived synovial fibroblasts at 0.6 to 3 uM preincubated for 3 hrs followed by TNFalpha stimulation measured after 18 hrs by sandwich immunoassay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490267 | Inhibition of Wnk3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKCDNIFITGPTGSVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490191 | Inhibition of MST3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAANVLLSEHGEVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID719898 | Inhibition of MEK1 | 2012 | Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
| Irreversible protein kinase inhibitors: balancing the benefits and risks. |
AID1490252 | Inhibition of TAK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPPNLLLVAGGTVLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1254042 | Inhibition of TAK1 (unknown origin) expressed in sf9 cells assessed as 32P level incorporation into myelin basic protein incubated for 5 mins at 30 degC by immunoprecipitation method | 2015 | Bioorganic & medicinal chemistry, Nov-01, Volume: 23, Issue:21
| Isolation, semisynthesis, covalent docking and transforming growth factor beta-activated kinase 1 (TAK1)-inhibitory activities of (5Z)-7-oxozeaenol analogues. |
AID480394 | Antiinflammatory activity in iv dosed mouse assessed as inhibition of LPS-stimulated TNFalpha production | 2010 | Bioorganic & medicinal chemistry letters, May-15, Volume: 20, Issue:10
| Discovery of an in vitro and in vivo potent resorcylic lactone analog of LL-Z1640-2 as anti-inflammatory lead, II. |
AID1490227 | Inhibition of PIP5K3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GGKSGAAFYATEDDRFILK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490192 | Inhibition of MST4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAANVLLSEQGDVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490275 | Inhibition of full length human MEK1 (1 to 393 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490194 | Inhibition of NDR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNLLLDSK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490127 | Inhibition of GSK3A in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPQNLLVDPDTAVLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490069 | Inhibition of ATR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FYIMMCKPK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490084 | Inhibition of CaMK2d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490276 | Inhibition of full length human MEK2 (1 to 400 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490128 | Inhibition of GSK3B in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPQNLLLDPDTAVLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490851 | Inhibition of human KIT (571 to 952 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490082 | Inhibition of CaMK2a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490854 | Inhibition of full length human MEK3 (1 to 318 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490075 | Inhibition of AurB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SHFIVALKVLFK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490204 | Inhibition of NuaK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LVAIKSIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1176815 | Inhibition of TAK1 (unknown origin) using unphosphorylated GST-tagged MAP2K7 substrate protein assessed as phosphorylation by ELISA | 2015 | Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
| 5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner. |
AID1336665 | Inhibition of human TAK1 (M1 to Q303 residues) expressed in mammalian expression system at 10 uM by KINOMEScan assay | 2017 | Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
| Structure-guided development of covalent TAK1 inhibitors. |
AID1490289 | Inhibition of human ZAK (1 to 331 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490298 | Antiproliferative activity against mouse BA/F3 cells harboring KRAS G12D mutant after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490239 | Inhibition of RSK1 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENILLDEEGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490134 | Inhibition of IKKe in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPGNIMR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID470411 | Antiinflammatory activity in human THP1 cells assessed as inhibition of LPS-induced TNFalpha production by PLAP reporter assay | 2009 | Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
| Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead. |
AID1490280 | Inhibition of human MEK4 (84 to 399 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490842 | Inhibition of full length human RIOK3 (1 to 519 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490852 | Inhibition of human TGFBR2 (218 to 567 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490197 | Inhibition of NEK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKTQNVFLTR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490290 | Inhibition of human PRKD2 (519 to 838 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490110 | Inhibition of Erk1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLLINTTCDLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490171 | Inhibition of MAP3K4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANIFLTSSGLIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490199 | Inhibition of NEK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPANVFITATGVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID606022 | Cytotoxicity against human MCF7 cells after 72 hrs by MTS assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID553212 | Metabolic stability in mouse blood assessed as compound conversion to metabolite C7'-C8' E isomer | 2011 | ACS medicinal chemistry letters, Jan-13, Volume: 2, Issue:1
| Kinase inhibition by deoxy analogues of the resorcylic lactone L-783277. |
AID470412 | Antiinflammatory activity in human B164 cells assessed as inhibition of LPS-induced Actin production by PLAP reporter assay | 2009 | Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
| Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead. |
AID1490316 | Antiproliferative activity against human NCI-H23 cells harboring KRAS G12C mutant at | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490844 | Inhibition of full length human MEK2 (1 to 400 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490117 | Inhibition of PDGFRb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490185 | Inhibition of MRCKb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNVLLDVNGHIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490131 | Inhibition of HPK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANILINDAGEVR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490242 | Inhibition of RSK1 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNILYVDESGNPECLR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490135 | Inhibition of TBK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPGNIMR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490274 | Inhibition of full length human RIOK3 (1 to 519 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490083 | Inhibition of CaMK2b in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLLASK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490293 | Inhibition of human BIKE (34 to 329 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490155 | Inhibition of LYN in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKTLKPGTMSVQAFLEEANLMK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490081 | Inhibition of CaMK1d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LFAVKCIPK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490853 | Inhibition of human STK36 (1 to 271 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1336664 | Inhibition of human TAK1 (M1 to Q303 residues) expressed in mammalian expression system at 1 uM by KINOMEScan assay | 2017 | Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
| Structure-guided development of covalent TAK1 inhibitors. |
AID1469808 | Inhibition of TNFalpha-PLAP (unknown origin) | 2017 | Journal of medicinal chemistry, 02-09, Volume: 60, Issue:3
| Covalent Modifiers: A Chemical Perspective on the Reactivity of α,β-Unsaturated Carbonyls with Thiols via Hetero-Michael Addition Reactions. |
AID606026 | Antimicrobial activity against Escherichia coli by agar plate diffusion assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID1490182 | Inhibition of MLK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSNNILLLQPIESDDMEHK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490220 | Inhibition of PFTAIRE2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLISHLGELK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490153 | Inhibition of LKB1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPGNLLLTTGGTLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490221 | Inhibition of PI4KB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VPHTQAVVLNSKDK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490283 | Inhibition of human KIT (571 to 952 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490113 | Inhibition of FER in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TSVAVKTCKEDLPQELK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490222 | Inhibition of PIK3C2B in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VIFKCGDDLRQDMLTLQMIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490145 | Inhibition of JNK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490065 | Inhibition of AMPKa1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENVLLDAHMNAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490137 | Inhibition of IRAK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled AIQFLHQDSPSLIHGDIKSSNVLLDER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490087 | Inhibition of CaMK2g in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TSTQEYAAKIINTK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490250 | Inhibition of STLK6 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SIKASHILISGDGLVTLSGLSHLHSLV probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490095 | Inhibition of CDK5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490073 | Inhibition of AurB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GKFGNVYLAR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490195 | Inhibition of NDR2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNLLLDAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490108 | Inhibition of EphA2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VLEDDPEATYTTSGGKIPIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID553123 | Metabolic stability in mouse plasma assessed as compound conversion to metabolite C7'-C8' E isomer | 2011 | ACS medicinal chemistry letters, Jan-13, Volume: 2, Issue:1
| Kinase inhibition by deoxy analogues of the resorcylic lactone L-783277. |
AID1490243 | Inhibition of RSK2 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNILYVDESGNPESIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490112 | Inhibition of Erk5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLLVNENCELK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID719900 | Inhibition of MKK4 | 2012 | Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
| Irreversible protein kinase inhibitors: balancing the benefits and risks. |
AID606021 | Cytotoxicity against human HT-29 cells after 72 hrs by MTS assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID1490156 | Inhibition of MAP2K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IMHRDVKPSNILVNSR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490098 | Inhibition of CHED in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKCSNILLNNR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490140 | Inhibition of IRE2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPGNILITGPDSQGLGR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490181 | Inhibition of MET in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TGAKLPVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490090 | Inhibition of CCRK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANLLISASGQLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490860 | Inhibition of human TAK1 (1 to 303 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490295 | Inhibition of human CDKL2 (1 to 327 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490088 | Inhibition of CaMK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENLLYATPAPDAPLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490862 | Inhibition of human VEGFR2 (787 to 1253 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490176 | Inhibition of MARK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAENLLLDADMNIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490224 | Inhibition of PIK3CB in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VFGEDSVGVIFKNGDDLRQDMLTLQMLR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490233 | Inhibition of PRP4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled CNILHADIKPDNILVNESK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490212 | Inhibition of PAK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IGQGASGTVFTATDVALGQEVAIKQINLQK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490310 | Antiproliferative activity against human URMC6 cells harboring wild type KRAS after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490189 | Inhibition of MST2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLNTEGHAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490123 | Inhibition of SRC in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QGAKFPIKWTAPEAALYGR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490863 | Inhibition of human CDKL2 (1 to 327 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID606028 | Antimicrobial activity against Mycobacterium smegmatis by agar plate diffusion assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID606029 | Antimicrobial activity against Bacillus subtilis by agar plate diffusion assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID1490190 | Inhibition of MST2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ESGQVVAIKQVPVESDLQEIIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490273 | Inhibition of ZC3/MINK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGQNVLLTENAEVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490068 | Inhibition of ARAF in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSNNIFLHEGLTVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490848 | Inhibition of human MEK4 (84 to 399 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490180 | Inhibition of MASTL in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LYAVKVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490211 | Inhibition of p70S6Kb in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENIMLSSQGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490278 | Inhibition of human MEK5 (98 to 448 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490178 | Inhibition of MARK3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAIKIIDKTQLNPTSLQK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490308 | Antiproliferative activity against human AsPC1 cells harboring KRAS G12D mutant after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490092 | Inhibition of CDK11 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANILVMGEGPER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490858 | Inhibition of human PRKD2 (519 to 838 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490270 | Inhibition of ZAP70 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ISDFGLSKALGADDSYYTAR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490105 | Inhibition of eEF2K in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YIKYNSNSGFVR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490272 | Inhibition of ZC2/TNIK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGQNVLLTENAEVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490183 | Inhibition of MLK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKSSNILLLEK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490218 | Inhibition of PCTAIRE3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKLTENLVALKEIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490106 | Inhibition of EGFR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled LLGAEEKEYHAEGGKVPIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490203 | Inhibition of NEK9 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKTLNIFLTK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID470678 | Half life in BALB/c mouse at 3 mg/kg, iv | 2009 | Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
| Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead. |
AID1490161 | Inhibition of MAP2K3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNVLINK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490213 | Inhibition of PAN3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VMDPTKILITGK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1336652 | Inhibition of full length recombinant human GST-tagged TAK1 expressed in baculovirus expression system after 1 hr by TR-FRET based LanthaScreen assay | 2017 | Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
| Structure-guided development of covalent TAK1 inhibitors. |
AID1490141 | Inhibition of JAK1 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QLASALSYLEDKDLVHGNVCTKNLLLAR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490859 | Inhibition of human RSK4 (1 to 397 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490188 | Inhibition of MST1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLNTEGHAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490130 | Inhibition of HER3/ErbB3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled GVWIPEGESIKIPVCIKVIEDK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID606031 | Inhibition of NFkappa p65 isolated from nuclear extract of human HeLa cells by ELISA | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID1490119 | Inhibition of FRAP in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IQSIAPSLQVITSKQRPR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1336653 | Inhibition of full length recombinant human His-tagged MEK1 expressed in baculovirus expression system after 1 hr by TR-FRET based LanthaScreen assay | 2017 | Bioorganic & medicinal chemistry, 02-01, Volume: 25, Issue:3
| Structure-guided development of covalent TAK1 inhibitors. |
AID1490086 | Inhibition of CaMK2d in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IPTGQEYAAKIINTKK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490317 | Antiproliferative activity against human NCI-H358 cells harboring KRAS G12C mutant at | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490149 | Inhibition of KSR2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKNVFYDNGK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1772488 | Inhibition of NF-kB (unknown origin) expressed in HEK293T cells transfected with pTK-Renilla reporter preincubated for 6 hrs followed by addition of TNF-alpha and measured after 8 hrs by Dual luciferase reporter assay | 2021 | European journal of medicinal chemistry, Nov-05, Volume: 223 | Design, synthesis, docking, molecular dynamics and bioevaluation studies on novel N-methylpicolinamide and thienopyrimidine derivatives with inhibiting NF-κB and TAK1 activities: Cheminformatics tools RDKit applied in drug design. |
AID1490163 | Inhibition of MAP2K5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKPSNMLVNTR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490187 | Inhibition of MST1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ETGQIVAIKQVPVESDLQEIIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490246 | Inhibition of SLK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKAGNILFTLDGDIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID606024 | Cytotoxicity against human SF268 cells after 72 hrs by MTS assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID1490234 | Inhibition of PRPK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FLSGLELVKQGAEAR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490109 | Inhibition of EphB2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled FLEDDTSDPTYTSALGGKIPIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490147 | Inhibition of KHS2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NVNTGELAAIKVIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490259 | Inhibition of TNK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SVPVAVKSLR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490172 | Inhibition of MAP3K5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGDNVLINTYSGVLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490299 | Antiproliferative activity against mouse BA/F3 cells harboring KRAS G12D mutant after 72 hrs in presence of IL-3 by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1176812 | Inhibition of MAP2K7 (unknown origin) using unphosphorylated GST-tagged JNK1 substrate protein assessed as phosphorylation by ELISA | 2015 | Bioorganic & medicinal chemistry letters, Feb-01, Volume: 25, Issue:3
| 5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner. |
AID1490064 | Inhibition of ACK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TVSVAVKCLKPDVLSQPEAMDDFIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490857 | Inhibition of human ZAK (1 to 331 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID553213 | Metabolic stability in human plasma assessed as compound conversion to metabolite C7'-C8' E isomer at 55 uM after 20 mins at 37 degC | 2011 | ACS medicinal chemistry letters, Jan-13, Volume: 2, Issue:1
| Kinase inhibition by deoxy analogues of the resorcylic lactone L-783277. |
AID1490260 | Inhibition of TTK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NMLEAVHTIHQHGIVHSDLKPANFLIDGMLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490256 | Inhibition of TBK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TGDLFAIKVFNNISFLRPVDVQMR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1613078 | Inhibition of full length TAK1/TAB1 (unknown origin) using biotin-MKK6 as substrate by AlphaScreen assay | 2019 | European journal of medicinal chemistry, Feb-01, Volume: 163 | Synthesis and anti-tumor activity of imidazopyrazines as TAK1 inhibitors. |
AID1490251 | Inhibition of SYK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ISDFGLSKALR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490120 | Inhibition of FRK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled HEIKLPVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490148 | Inhibition of KSR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKNVFYDNGK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490833 | Inhibition of TAK1 in RA patient-derived synovial fibroblasts assessed as inhibition of poly(I:C)-induced cytokine secretion at 0.6 uM preincubated for 3 hrs followed by poly(I:C) stimulation measured after 18 hrs by sandwich immunoassay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490217 | Inhibition of PCTAIRE2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKLTENLVALKEIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490264 | Inhibition of Wee1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YIHSMSLVHMDIKPSNIFISR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490158 | Inhibition of MAP2K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled KLIHLEIKPAIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490306 | Antiproliferative activity against human SKCO1 cells harboring KRAS G12V mutant after 72 hrs by CellTiter-Glo assay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490157 | Inhibition of MAP2K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled KLIHLEIKPAIR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490287 | Inhibition of human PDGFRA (575 to 1002 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490186 | Inhibition of MSK2 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKLENVLLDSEGHIVLTDFGLSK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490136 | Inhibition of ILK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled WQGNDIVVKVLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490845 | Inhibition of human PDGFRB (582 to 1009 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490196 | Inhibition of NEK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKSQNIFLTK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490168 | Inhibition of MAP3K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ELAVKQVQFDPDSPETSKEVNALECEQLLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490232 | Inhibition of PLK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled CFEISDADTKEVFAGKIVPK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490124 | Inhibition of YES in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled QGAKFPIKWTAPEAALYGR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490247 | Inhibition of SMG1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DTVTIHSVGGTITILPTKTKPK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490265 | Inhibition of Wnk1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKCDNIFITGPTGSVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490151 | Inhibition of LATS2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKPDNILIDLDGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490076 | Inhibition of AXL in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled NCMLNENMSVCVADFGLSKK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490277 | Inhibition of human PDGFRB (582 to 1009 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490116 | Inhibition of FMS in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490861 | Inhibition of human BIKE (34 to 329 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490150 | Inhibition of LATS1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ALYATKTLR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490856 | Inhibition of human ACVR1 (188 to 509 residues) expressed in bacterial expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490118 | Inhibition of TYRO3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490237 | Inhibition of RON in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IQCAIKSLSR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490215 | Inhibition of PCTAIRE1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINER probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490230 | Inhibition of PKCz in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKLDNVLLDADGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490253 | Inhibition of TAO1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKAGNILLTEPGQVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490231 | Inhibition of PKR in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIFLVDTK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID719899 | Inhibition of MEK7 | 2012 | Journal of medicinal chemistry, Jul-26, Volume: 55, Issue:14
| Irreversible protein kinase inhibitors: balancing the benefits and risks. |
AID1490179 | Inhibition of MAST3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPDNLLITSLGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490206 | Inhibition of p38a in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNLAVNEDCELK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID606025 | Cytotoxicity against human MDA-MB-435 cells after 72 hrs by MTS assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID1490249 | Inhibition of STLK5 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YSVKVLPWLSPEVLQQNLQGYDAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490284 | Inhibition of human TGFBR2 (218 to 567 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490312 | Inhibition of biotin-labeled N-(2-(2-(2-(2-(4-(4-((4-((2-Acrylamidophenyl)amino)-5-chloropyrimidin-2-yl)amino)phenyl)piperazin-1-yl)ethoxy)ethoxy)ethoxy)ethyl)-5-((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanamide probe binding to TAK1 | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490078 | Inhibition of BMPR1A in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled SKNILIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490228 | Inhibition of PITSLRE in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKTSNLLLSHAGILK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490257 | Inhibition of TLK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled YLNEIKPPIIHYDLKPGNILLVDGTACEIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID470680 | Metabolic stability in mouse plasma after 2 hrs | 2009 | Bioorganic & medicinal chemistry letters, Nov-01, Volume: 19, Issue:21
| Discovery of a potent, metabolically stabilized resorcylic lactone as an anti-inflammatory lead. |
AID1490142 | Inhibition of JAK1 domain2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled IGDFGLTKAIETDKEYYTVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490121 | Inhibition of FYN in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAIKTLKPGTMSPESFLEEAQIMK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490286 | Inhibition of full length human MEK3 (1 to 318 residues) expressed in mammalian expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490255 | Inhibition of TAO2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKAGNILLSEPGLVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490244 | Inhibition of RSKL1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VLGVIDKVLLVMDTR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490138 | Inhibition of IRAK4 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKSANILLDEAFTAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490223 | Inhibition of PIK3C3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TEDGGKYPVIFKHGDDLRQDQLILQIISLMDK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490077 | Inhibition of BARK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPANILLDEHGHVR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490166 | Inhibition of MAP3K1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DVKGANLLIDSTGQR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490240 | Inhibition of RSK2 domain1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPENILLDEEGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490143 | Inhibition of JNK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490288 | Inhibition of human ACVR1 (188 to 509 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490831 | Inhibition of TAK1 in RA patient-derived synovial fibroblasts assessed as inhibition of TNFalpha-induced cytokine secretion at 0.6 uM preincubated for 3 hrs followed by TNFalpha stimulation measured after 18 hrs by sandwich immunoassay | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490229 | Inhibition of PKCi in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKLDNVLLDSEGHIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490855 | Inhibition of human PDGFRA (575 to 1002 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490094 | Inhibition of CDK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNLLINTEGAIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID606023 | Cytotoxicity against human H460 cells after 72 hrs by MTS assay | 2011 | Journal of natural products, May-27, Volume: 74, Issue:5
| Resorcylic acid lactones with cytotoxic and NF-κB inhibitory activities and their structure-activity relationships. |
AID652590 | Inhibition of TAK-1 | 2011 | ACS medicinal chemistry letters, Sep-08, Volume: 2, Issue:9
| Exploring aigialomycin d and its analogues as protein kinase inhibitors for cancer targets. |
AID1490101 | Inhibition of CRK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKCSNILLNNSGQIK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490262 | Inhibition of ULK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNILLSYANR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1436865 | Binding affinity to recombinant human biotinylated N-terminal GST-tagged TAK1 (1 to 303 residues) fused with TAB1 (437 to 504 residues) expressed in baculovirus infected sf9 cells at 100 nM in presence of ATP by SPR assay | 2017 | Bioorganic & medicinal chemistry letters, 02-15, Volume: 27, Issue:4
| Identification of a selective inhibitor of transforming growth factor β-activated kinase 1 by biosensor-based screening of focused libraries. |
AID1490125 | Inhibition of GCK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANLLLTLQGDVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490225 | Inhibition of PIP4K2A in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled AKELPTLKDNDFINEGQK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490115 | Inhibition of FGFR1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled VAVKMLK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490067 | Inhibition of ANKRD3 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled TWLAIKCSPSLHVDDR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490261 | Inhibition of ULK1 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPQNILLSNPAGR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490285 | Inhibition of human STK36 (1 to 271 residues) expressed in bacterial expression system assessed as enzyme activity at 1 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490843 | Inhibition of full length human MEK1 (1 to 393 residues) expressed in mammalian expression system assessed as enzyme activity at 10 uM by KINOMEScan assay relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490201 | Inhibition of NEK7 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled AACLLDGVPVALKK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490103 | Inhibition of DNAPK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EHPFLVKGGEDLR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490263 | Inhibition of VRK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled MLDVLEYIHENEYVHGDIKAANLLLYK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490175 | Inhibition of MARK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled EVAVKIIDKTQLNSSSLQK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490202 | Inhibition of NEK8 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKTQNILLDK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490089 | Inhibition of CASK in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled ETGQQFAVKIVDVAK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490144 | Inhibition of JNK2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DLKPSNIVVK probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1490169 | Inhibition of MAP3K2 in human SKCO1 cells at 1 uM after 4 hrs using biotin labeled DIKGANILR probe by mass-spectrometric analysis relative to control | 2017 | Bioorganic & medicinal chemistry, 02-15, Volume: 25, Issue:4
| Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. |
AID1296008 | Cytotoxic Profiling of Annotated Libraries Using Quantitative High-Throughput Screening | 2020 | SLAS discovery : advancing life sciences R & D, 01, Volume: 25, Issue:1
| Cytotoxic Profiling of Annotated and Diverse Chemical Libraries Using Quantitative High-Throughput Screening. |
AID1347160 | Primary screen NINDS Rhodamine qHTS for Zika virus inhibitors | 2020 | Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
| Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors. |
AID1347159 | Primary screen GU Rhodamine qHTS for Zika virus inhibitors: Unlinked NS2B-NS3 protease assay | 2020 | Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
| Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors. |
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023] |