Page last updated: 2024-11-13

gsk 2334470

Description Research Excerpts Clinical Trials Roles Classes Pathways Study Profile Bioassays Related Drugs Related Conditions Protein Interactions Research Growth Market Indicators

Description

GSK 2334470: a PDK1 inhibitor; structure in first source [Medical Subject Headings (MeSH), National Library of Medicine, extracted Dec-2023]

Cross-References

ID SourceID
PubMed CID46215815
CHEMBL ID1765740
CHEBI ID91465
SCHEMBL ID1317022
MeSH IDM0553877

Synonyms (38)

Synonym
gsk2334470
HY-14981
SCHEMBL1317022
bdbm50341243
(3s,6r)-1-[6-(3-amino-1h-indazol-6-yl)-2-(methylamino)-4-pyrimidinyl]-n-cyclohexyl-6-methyl-3-piperidinecarboxamide
chembl1765740 ,
CS-0917
S7087
BRD-K70642949-001-01-1
1227911-45-6
(3s,6r)-1-[6-(3-amino-1h-indazol-6-yl)-2-(methylamino)pyrimidin-4-yl]-n-cyclohexyl-6-methylpiperidine-3-carboxamide
gsk-2334470
gsk 2334470
gtpl8008
MLS006011255
smr004703010
QLPHOXTXAKOFMU-WBVHZDCISA-N ,
AC-32824
AKOS024458000
J-004855
DTXSID40673111
3-piperidinecarboxamide, 1-[6-(3-amino-1h-indazol-6-yl)-2-(methylamino)-4-pyrimidinyl]-n-cyclohexyl-6-methyl-, (3s,6r)-
CHEBI:91465
gsk2334470, >=98% (hplc)
pdk1 inhibitor gs2334470
SW219485-1
EX-A1544
Q27077885
AS-16973
unii-qb5bf4gj87
qb5bf4gj87 ,
(3s,6r)-1-(6-(3-amino-1h-indazol-6-yl)-2-(methylamino)-4-pyrimidinyl)-n-cyclohexyl-6-methyl-3-piperidinecarboxamide
3-piperidinecarboxamide, 1-(6-(3-amino-1h-indazol-6-yl)-2-(methylamino)-4-pyrimidinyl)-n-cyclohexyl-6-methyl-, (3s,6r)-
(3s,6r)-1-(6-(3-amino-1h-indazol-6-yl)-2-(methylamino)pyrimidin-4-yl)-n-cyclohexyl-6-methylpiperidine-3-carboxamide
CCG-269373
C71892
nsc759658
nsc-759658

Research Excerpts

Bioavailability

ExcerptReferenceRelevance
" Additionally, an ∼85% correlation was obtained between PAMPA pH 5 permeability and in vivo oral bioavailability in mice and rats."( Using in vitro ADME data for lead compound selection: An emphasis on PAMPA pH 5 permeability and oral bioavailability.
Itkin, M; Kabir, M; Mathé, EA; Nguyễn, ÐT; Padilha, EC; Shah, P; Shinn, P; Siramshetty, V; Wang, AQ; Williams, J; Xu, X; Yu, KR; Zhao, T, 2022
)
0.72
[information is derived through text-mining from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Drug Classes (1)

ClassDescription
indazoles
[compound class information is derived from Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Protein Targets (17)

Potency Measurements

ProteinTaxonomyMeasurementAverage (µ)Min (ref.)Avg (ref.)Max (ref.)Bioassay(s)
PPM1D proteinHomo sapiens (human)Potency13.13730.00529.466132.9993AID1347411
Interferon betaHomo sapiens (human)Potency13.13730.00339.158239.8107AID1347411
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Inhibition Measurements

ProteinTaxonomyMeasurementAverageMin (ref.)Avg (ref.)Max (ref.)Bioassay(s)
Aurora kinase AHomo sapiens (human)IC50 (µMol)24.90500.00000.46208.6000AID592179
Inhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)IC50 (µMol)25.11800.03901.40367.4000AID592284
3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)IC50 (µMol)0.06100.00251.45139.0000AID1310405; AID1912655; AID1913065; AID592178; AID592183; AID592184; AID641893; AID729481
Epidermal growth factor receptorHomo sapiens (human)IC50 (µMol)10.00000.00000.536910.0000AID592282
RAC-alpha serine/threonine-protein kinaseHomo sapiens (human)IC50 (µMol)10.00000.00020.738710.0000AID592280
Vascular endothelial growth factor receptor 2Homo sapiens (human)IC50 (µMol)10.00000.00000.48308.8000AID592287
TGF-beta receptor type-1Homo sapiens (human)IC50 (µMol)10.00000.00100.643610.0000AID592181
Tyrosine-protein kinase SYKHomo sapiens (human)IC50 (µMol)25.11800.00010.826010.0000AID592286
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)IC50 (µMol)25.11800.00030.660710.0000AID592285
Glycogen synthase kinase-3 betaHomo sapiens (human)IC50 (µMol)25.11800.00060.801310.0000AID592283
Rho-associated protein kinase 1Homo sapiens (human)IC50 (µMol)7.94310.00040.854910.0000AID1913466; AID592182
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)IC50 (µMol)0.00250.00051.89099.5000AID1913452
Growth hormone secretagogue receptor type 1Homo sapiens (human)IC50 (µMol)24.90500.00040.58926.0000AID592179
Aurora kinase BHomo sapiens (human)IC50 (µMol)3.16210.00030.96349.8000AID1913455; AID592180
Mitogen-activated protein kinase kinase kinase 5Homo sapiens (human)IC50 (µMol)27.54200.00071.17137.0000AID592281
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Biological Processes (671)

Processvia Protein(s)Taxonomy
protein phosphorylationAurora kinase AHomo sapiens (human)
response to woundingAurora kinase AHomo sapiens (human)
liver regenerationAurora kinase AHomo sapiens (human)
G2/M transition of mitotic cell cycleAurora kinase AHomo sapiens (human)
mitotic cell cycleAurora kinase AHomo sapiens (human)
chromatin remodelingAurora kinase AHomo sapiens (human)
protein phosphorylationAurora kinase AHomo sapiens (human)
apoptotic processAurora kinase AHomo sapiens (human)
spindle organizationAurora kinase AHomo sapiens (human)
spindle assembly involved in female meiosis IAurora kinase AHomo sapiens (human)
mitotic centrosome separationAurora kinase AHomo sapiens (human)
anterior/posterior axis specificationAurora kinase AHomo sapiens (human)
regulation of G2/M transition of mitotic cell cycleAurora kinase AHomo sapiens (human)
negative regulation of gene expressionAurora kinase AHomo sapiens (human)
peptidyl-serine phosphorylationAurora kinase AHomo sapiens (human)
regulation of protein stabilityAurora kinase AHomo sapiens (human)
negative regulation of protein bindingAurora kinase AHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processAurora kinase AHomo sapiens (human)
negative regulation of apoptotic processAurora kinase AHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processAurora kinase AHomo sapiens (human)
positive regulation of mitotic nuclear divisionAurora kinase AHomo sapiens (human)
positive regulation of mitotic cell cycleAurora kinase AHomo sapiens (human)
regulation of centrosome cycleAurora kinase AHomo sapiens (human)
protein autophosphorylationAurora kinase AHomo sapiens (human)
cell divisionAurora kinase AHomo sapiens (human)
centrosome localizationAurora kinase AHomo sapiens (human)
cilium disassemblyAurora kinase AHomo sapiens (human)
protein localization to centrosomeAurora kinase AHomo sapiens (human)
positive regulation of mitochondrial fissionAurora kinase AHomo sapiens (human)
positive regulation of oocyte maturationAurora kinase AHomo sapiens (human)
regulation of signal transduction by p53 class mediatorAurora kinase AHomo sapiens (human)
neuron projection extensionAurora kinase AHomo sapiens (human)
mitotic spindle organizationAurora kinase AHomo sapiens (human)
regulation of cytokinesisAurora kinase AHomo sapiens (human)
skeletal muscle contractionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
protein phosphorylationInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
inflammatory responseInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
immune responseInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
canonical NF-kappaB signal transductionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
I-kappaB phosphorylationInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
Rho protein signal transductionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to xenobiotic stimulusInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to virusInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to toxic substanceInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
anatomical structure morphogenesisInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to acetateInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
negative regulation of NF-kappaB transcription factor activityInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to lipopolysaccharideInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
positive regulation of interferon-alpha productionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to hydroperoxideInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
tumor necrosis factor-mediated signaling pathwayInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
toll-like receptor 4 signaling pathwayInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cellular response to reactive oxygen speciesInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
non-canonical NF-kappaB signal transductionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
positive regulation of canonical NF-kappaB signal transductionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to amino acidInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
innate immune responseInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
positive regulation of DNA-templated transcriptionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
positive regulation of NF-kappaB transcription factor activityInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
striated muscle cell differentiationInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
response to cholecystokininInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cellular response to cadmium ionInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cellular response to tumor necrosis factorInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cellular response to virusInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
peptidyl-serine phosphorylationInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
intracellular signal transduction3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
type B pancreatic cell development3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
protein phosphorylation3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
negative regulation of protein kinase activity3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
hyperosmotic response3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
epidermal growth factor receptor signaling pathway3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
insulin receptor signaling pathway3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of phospholipase activity3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
negative regulation of cardiac muscle cell apoptotic process3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cell migration3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
peptidyl-threonine phosphorylation3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
calcium-mediated signaling3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
actin cytoskeleton organization3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
negative regulation of transforming growth factor beta receptor signaling pathway3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
T cell costimulation3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
activation of protein kinase B activity3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cellular response to insulin stimulus3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
negative regulation of toll-like receptor signaling pathway3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
regulation of canonical NF-kappaB signal transduction3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
regulation of mast cell degranulation3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of blood vessel endothelial cell migration3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of angiogenesis3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
protein autophosphorylation3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
insulin-like growth factor receptor signaling pathway3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of release of sequestered calcium ion into cytosol3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cellular response to epidermal growth factor stimulus3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
extrinsic apoptotic signaling pathway3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of protein localization to plasma membrane3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of sprouting angiogenesis3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
positive regulation of vascular endothelial cell proliferation3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
negative regulation of endothelial cell apoptotic process3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
peptidyl-serine phosphorylation3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
intracellular signal transduction3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cell surface receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell population proliferationEpidermal growth factor receptorHomo sapiens (human)
MAPK cascadeEpidermal growth factor receptorHomo sapiens (human)
ossificationEpidermal growth factor receptorHomo sapiens (human)
embryonic placenta developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of protein phosphorylationEpidermal growth factor receptorHomo sapiens (human)
hair follicle developmentEpidermal growth factor receptorHomo sapiens (human)
translationEpidermal growth factor receptorHomo sapiens (human)
signal transductionEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
activation of phospholipase C activityEpidermal growth factor receptorHomo sapiens (human)
salivary gland morphogenesisEpidermal growth factor receptorHomo sapiens (human)
midgut developmentEpidermal growth factor receptorHomo sapiens (human)
learning or memoryEpidermal growth factor receptorHomo sapiens (human)
circadian rhythmEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell population proliferationEpidermal growth factor receptorHomo sapiens (human)
diterpenoid metabolic processEpidermal growth factor receptorHomo sapiens (human)
peptidyl-tyrosine phosphorylationEpidermal growth factor receptorHomo sapiens (human)
cerebral cortex cell migrationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell growthEpidermal growth factor receptorHomo sapiens (human)
lung developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cell migrationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of superoxide anion generationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylationEpidermal growth factor receptorHomo sapiens (human)
response to cobalaminEpidermal growth factor receptorHomo sapiens (human)
response to hydroxyisoflavoneEpidermal growth factor receptorHomo sapiens (human)
cellular response to reactive oxygen speciesEpidermal growth factor receptorHomo sapiens (human)
peptidyl-tyrosine autophosphorylationEpidermal growth factor receptorHomo sapiens (human)
ERBB2-EGFR signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
negative regulation of epidermal growth factor receptor signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
negative regulation of protein catabolic processEpidermal growth factor receptorHomo sapiens (human)
vasodilationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of phosphorylationEpidermal growth factor receptorHomo sapiens (human)
ovulation cycleEpidermal growth factor receptorHomo sapiens (human)
hydrogen peroxide metabolic processEpidermal growth factor receptorHomo sapiens (human)
negative regulation of apoptotic processEpidermal growth factor receptorHomo sapiens (human)
positive regulation of MAP kinase activityEpidermal growth factor receptorHomo sapiens (human)
tongue developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of cyclin-dependent protein serine/threonine kinase activityEpidermal growth factor receptorHomo sapiens (human)
positive regulation of DNA repairEpidermal growth factor receptorHomo sapiens (human)
positive regulation of DNA replicationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of bone resorptionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of DNA-templated transcriptionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of vasoconstrictionEpidermal growth factor receptorHomo sapiens (human)
negative regulation of mitotic cell cycleEpidermal growth factor receptorHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIEpidermal growth factor receptorHomo sapiens (human)
regulation of JNK cascadeEpidermal growth factor receptorHomo sapiens (human)
symbiont entry into host cellEpidermal growth factor receptorHomo sapiens (human)
protein autophosphorylationEpidermal growth factor receptorHomo sapiens (human)
astrocyte activationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of fibroblast proliferationEpidermal growth factor receptorHomo sapiens (human)
digestive tract morphogenesisEpidermal growth factor receptorHomo sapiens (human)
positive regulation of smooth muscle cell proliferationEpidermal growth factor receptorHomo sapiens (human)
neuron projection morphogenesisEpidermal growth factor receptorHomo sapiens (human)
epithelial cell proliferationEpidermal growth factor receptorHomo sapiens (human)
positive regulation of epithelial cell proliferationEpidermal growth factor receptorHomo sapiens (human)
regulation of peptidyl-tyrosine phosphorylationEpidermal growth factor receptorHomo sapiens (human)
protein insertion into membraneEpidermal growth factor receptorHomo sapiens (human)
response to calcium ionEpidermal growth factor receptorHomo sapiens (human)
regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of synaptic transmission, glutamatergicEpidermal growth factor receptorHomo sapiens (human)
positive regulation of glial cell proliferationEpidermal growth factor receptorHomo sapiens (human)
morphogenesis of an epithelial foldEpidermal growth factor receptorHomo sapiens (human)
eyelid development in camera-type eyeEpidermal growth factor receptorHomo sapiens (human)
response to UV-AEpidermal growth factor receptorHomo sapiens (human)
positive regulation of mucus secretionEpidermal growth factor receptorHomo sapiens (human)
regulation of ERK1 and ERK2 cascadeEpidermal growth factor receptorHomo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeEpidermal growth factor receptorHomo sapiens (human)
cellular response to amino acid stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to mechanical stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to cadmium ionEpidermal growth factor receptorHomo sapiens (human)
cellular response to epidermal growth factor stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to estradiol stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to xenobiotic stimulusEpidermal growth factor receptorHomo sapiens (human)
cellular response to dexamethasone stimulusEpidermal growth factor receptorHomo sapiens (human)
positive regulation of canonical Wnt signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
liver regenerationEpidermal growth factor receptorHomo sapiens (human)
cell-cell adhesionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of protein kinase C activityEpidermal growth factor receptorHomo sapiens (human)
positive regulation of G1/S transition of mitotic cell cycleEpidermal growth factor receptorHomo sapiens (human)
positive regulation of non-canonical NF-kappaB signal transductionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of prolactin secretionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of miRNA transcriptionEpidermal growth factor receptorHomo sapiens (human)
positive regulation of protein localization to plasma membraneEpidermal growth factor receptorHomo sapiens (human)
negative regulation of cardiocyte differentiationEpidermal growth factor receptorHomo sapiens (human)
neurogenesisEpidermal growth factor receptorHomo sapiens (human)
multicellular organism developmentEpidermal growth factor receptorHomo sapiens (human)
positive regulation of kinase activityEpidermal growth factor receptorHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayEpidermal growth factor receptorHomo sapiens (human)
cell surface receptor signaling pathway via JAK-STATInterferon betaHomo sapiens (human)
response to exogenous dsRNAInterferon betaHomo sapiens (human)
B cell activation involved in immune responseInterferon betaHomo sapiens (human)
cell surface receptor signaling pathwayInterferon betaHomo sapiens (human)
cell surface receptor signaling pathway via JAK-STATInterferon betaHomo sapiens (human)
response to virusInterferon betaHomo sapiens (human)
positive regulation of autophagyInterferon betaHomo sapiens (human)
cytokine-mediated signaling pathwayInterferon betaHomo sapiens (human)
natural killer cell activationInterferon betaHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylation of STAT proteinInterferon betaHomo sapiens (human)
cellular response to interferon-betaInterferon betaHomo sapiens (human)
B cell proliferationInterferon betaHomo sapiens (human)
negative regulation of viral genome replicationInterferon betaHomo sapiens (human)
innate immune responseInterferon betaHomo sapiens (human)
positive regulation of innate immune responseInterferon betaHomo sapiens (human)
regulation of MHC class I biosynthetic processInterferon betaHomo sapiens (human)
negative regulation of T cell differentiationInterferon betaHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIInterferon betaHomo sapiens (human)
defense response to virusInterferon betaHomo sapiens (human)
type I interferon-mediated signaling pathwayInterferon betaHomo sapiens (human)
neuron cellular homeostasisInterferon betaHomo sapiens (human)
cellular response to exogenous dsRNAInterferon betaHomo sapiens (human)
cellular response to virusInterferon betaHomo sapiens (human)
negative regulation of Lewy body formationInterferon betaHomo sapiens (human)
negative regulation of T-helper 2 cell cytokine productionInterferon betaHomo sapiens (human)
positive regulation of apoptotic signaling pathwayInterferon betaHomo sapiens (human)
response to exogenous dsRNAInterferon betaHomo sapiens (human)
B cell differentiationInterferon betaHomo sapiens (human)
natural killer cell activation involved in immune responseInterferon betaHomo sapiens (human)
adaptive immune responseInterferon betaHomo sapiens (human)
T cell activation involved in immune responseInterferon betaHomo sapiens (human)
humoral immune responseInterferon betaHomo sapiens (human)
protein phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
activation-induced cell death of T cellsRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
intracellular signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
osteoblast differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
maternal placenta developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of endothelial cell proliferationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell migration involved in sprouting angiogenesisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
sphingosine-1-phosphate receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glycogen biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of glycogen biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glucose metabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of translationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein import into nucleusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nitric oxide biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
inflammatory responseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to oxidative stressRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
epidermal growth factor receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
G protein-coupled receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
canonical NF-kappaB signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell population proliferationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
insulin receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
apoptotic mitochondrial changesRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to heatRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
gene expressionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of autophagyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of endothelial cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of gene expressionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of gene expressionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of long-chain fatty acid import across plasma membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
fibroblast migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of fibroblast migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of sodium ion transportRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glucose metabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of endopeptidase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of neuron projection developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of macroautophagyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein ubiquitinationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
peptidyl-serine phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
peptidyl-threonine phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
virus-mediated perturbation of host defense responseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cytokine-mediated signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
mammalian oogenesis stageRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell growthRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
T cell costimulationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein ubiquitinationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of myelinationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
lipopolysaccharide-mediated signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
TOR signalingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of fatty acid beta-oxidationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of endodeoxyribonuclease activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to foodRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
peripheral nervous system myelin maintenanceRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to insulin stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of peptidyl-serine phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to fluid shear stressRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to reactive oxygen speciesRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
interleukin-18-mediated signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to vascular endothelial growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to decreased oxygen levelsRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
non-canonical NF-kappaB signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glucose homeostasisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of apoptotic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of apoptotic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of cysteine-type endopeptidase activity involved in apoptotic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
anoikisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of mRNA stabilityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphatidylinositol 3-kinase/protein kinase B signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of blood vessel endothelial cell migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of nitric oxide biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of fat cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glycogen biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of cyclin-dependent protein serine/threonine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of Notch signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of proteolysisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of DNA-templated transcriptionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of transcription by RNA polymerase IIRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of glucose importRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of organ growthRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein autophosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of lipid biosynthetic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
insulin-like growth factor receptor signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
behavioral response to painRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of smooth muscle cell proliferationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of nitric-oxide synthase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of DNA-binding transcription factor activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
striated muscle cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein metabolic processRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
excitatory postsynaptic potentialRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to growth hormoneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
mammary gland epithelial cell differentiationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
labyrinthine layer blood vessel developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to UV-ARAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to growth factorRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to cadmium ionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to tumor necrosis factorRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to epidermal growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to prostaglandin E stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein serine/threonine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
establishment of protein localization to mitochondrionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
maintenance of protein location in mitochondrionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of release of cytochrome c from mitochondriaRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to granulocyte macrophage colony-stimulating factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
execution phase of apoptosisRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of postsynapse organizationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of tRNA methylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to oxidised low-density lipoprotein particle stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of protein localization to lysosomeRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of cGAS/STING signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of G1/S transition of mitotic cell cycleRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to nucleusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to peptideRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of signal transduction by p53 class mediatorRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of cilium assemblyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathwayRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of leukocyte cell-cell adhesionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to plasma membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of I-kappaB phosphorylationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of TORC1 signalingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to endoplasmic reticulumRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cellular response to nerve growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
response to insulin-like growth factor stimulusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
positive regulation of protein localization to cell surfaceRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
regulation of type B pancreatic cell developmentRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of lymphocyte migrationRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathway in absence of ligandRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
intracellular signal transductionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
branching involved in blood vessel morphogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of macroautophagyVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of mitochondrial depolarizationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of mitochondrial fissionVascular endothelial growth factor receptor 2Homo sapiens (human)
angiogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
ovarian follicle developmentVascular endothelial growth factor receptor 2Homo sapiens (human)
vasculogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of protein phosphorylationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of endothelial cell proliferationVascular endothelial growth factor receptor 2Homo sapiens (human)
lymph vessel developmentVascular endothelial growth factor receptor 2Homo sapiens (human)
cell migration involved in sprouting angiogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of mesenchymal cell proliferationVascular endothelial growth factor receptor 2Homo sapiens (human)
epithelial cell maturationVascular endothelial growth factor receptor 2Homo sapiens (human)
endocardium developmentVascular endothelial growth factor receptor 2Homo sapiens (human)
endothelium developmentVascular endothelial growth factor receptor 2Homo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of cell population proliferationVascular endothelial growth factor receptor 2Homo sapiens (human)
regulation of cell shapeVascular endothelial growth factor receptor 2Homo sapiens (human)
mesenchymal cell proliferationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of endothelial cell migrationVascular endothelial growth factor receptor 2Homo sapiens (human)
negative regulation of gene expressionVascular endothelial growth factor receptor 2Homo sapiens (human)
peptidyl-tyrosine phosphorylationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of cell migrationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of BMP signaling pathwayVascular endothelial growth factor receptor 2Homo sapiens (human)
embryonic hemopoiesisVascular endothelial growth factor receptor 2Homo sapiens (human)
cellular response to vascular endothelial growth factor stimulusVascular endothelial growth factor receptor 2Homo sapiens (human)
vascular endothelial growth factor receptor-2 signaling pathwayVascular endothelial growth factor receptor 2Homo sapiens (human)
peptidyl-tyrosine autophosphorylationVascular endothelial growth factor receptor 2Homo sapiens (human)
vascular endothelial growth factor signaling pathwayVascular endothelial growth factor receptor 2Homo sapiens (human)
surfactant homeostasisVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of MAPK cascadeVascular endothelial growth factor receptor 2Homo sapiens (human)
negative regulation of neuron apoptotic processVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of blood vessel endothelial cell migrationVascular endothelial growth factor receptor 2Homo sapiens (human)
cell fate commitmentVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of angiogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
protein autophosphorylationVascular endothelial growth factor receptor 2Homo sapiens (human)
vascular endothelial growth factor receptor signaling pathwayVascular endothelial growth factor receptor 2Homo sapiens (human)
lung alveolus developmentVascular endothelial growth factor receptor 2Homo sapiens (human)
post-embryonic camera-type eye morphogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
epithelial cell proliferationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of positive chemotaxisVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of nitric-oxide synthase biosynthetic processVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of focal adhesion assemblyVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionVascular endothelial growth factor receptor 2Homo sapiens (human)
calcium ion homeostasisVascular endothelial growth factor receptor 2Homo sapiens (human)
blood vessel endothelial cell differentiationVascular endothelial growth factor receptor 2Homo sapiens (human)
vascular wound healingVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of ERK1 and ERK2 cascadeVascular endothelial growth factor receptor 2Homo sapiens (human)
semaphorin-plexin signaling pathwayVascular endothelial growth factor receptor 2Homo sapiens (human)
stem cell proliferationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of cell migration involved in sprouting angiogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
regulation of hematopoietic progenitor cell differentiationVascular endothelial growth factor receptor 2Homo sapiens (human)
regulation of bone developmentVascular endothelial growth factor receptor 2Homo sapiens (human)
cellular response to hydrogen sulfideVascular endothelial growth factor receptor 2Homo sapiens (human)
negative regulation of endothelial cell apoptotic processVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of stem cell proliferationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of endothelial cell chemotaxisVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of vasculogenesisVascular endothelial growth factor receptor 2Homo sapiens (human)
regulation of MAPK cascadeVascular endothelial growth factor receptor 2Homo sapiens (human)
multicellular organism developmentVascular endothelial growth factor receptor 2Homo sapiens (human)
cell migrationVascular endothelial growth factor receptor 2Homo sapiens (human)
endothelial cell differentiationVascular endothelial growth factor receptor 2Homo sapiens (human)
positive regulation of kinase activityVascular endothelial growth factor receptor 2Homo sapiens (human)
proepicardium developmentTGF-beta receptor type-1Homo sapiens (human)
negative regulation of cell migrationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of extracellular matrix assemblyTGF-beta receptor type-1Homo sapiens (human)
skeletal system developmentTGF-beta receptor type-1Homo sapiens (human)
in utero embryonic developmentTGF-beta receptor type-1Homo sapiens (human)
kidney developmentTGF-beta receptor type-1Homo sapiens (human)
blastocyst developmentTGF-beta receptor type-1Homo sapiens (human)
epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
endothelial cell proliferationTGF-beta receptor type-1Homo sapiens (human)
negative regulation of endothelial cell proliferationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of endothelial cell proliferationTGF-beta receptor type-1Homo sapiens (human)
lens development in camera-type eyeTGF-beta receptor type-1Homo sapiens (human)
ventricular trabecula myocardium morphogenesisTGF-beta receptor type-1Homo sapiens (human)
ventricular compact myocardium morphogenesisTGF-beta receptor type-1Homo sapiens (human)
regulation of DNA-templated transcriptionTGF-beta receptor type-1Homo sapiens (human)
apoptotic processTGF-beta receptor type-1Homo sapiens (human)
signal transductionTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta receptor signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
heart developmentTGF-beta receptor type-1Homo sapiens (human)
positive regulation of cell population proliferationTGF-beta receptor type-1Homo sapiens (human)
germ cell migrationTGF-beta receptor type-1Homo sapiens (human)
male gonad developmentTGF-beta receptor type-1Homo sapiens (human)
post-embryonic developmentTGF-beta receptor type-1Homo sapiens (human)
anterior/posterior pattern specificationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of gene expressionTGF-beta receptor type-1Homo sapiens (human)
regulation of epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
positive regulation of epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
peptidyl-serine phosphorylationTGF-beta receptor type-1Homo sapiens (human)
collagen fibril organizationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of cell growthTGF-beta receptor type-1Homo sapiens (human)
positive regulation of cell migrationTGF-beta receptor type-1Homo sapiens (human)
regulation of protein ubiquitinationTGF-beta receptor type-1Homo sapiens (human)
negative regulation of chondrocyte differentiationTGF-beta receptor type-1Homo sapiens (human)
activin receptor signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
intracellular signal transductionTGF-beta receptor type-1Homo sapiens (human)
myofibroblast differentiationTGF-beta receptor type-1Homo sapiens (human)
wound healingTGF-beta receptor type-1Homo sapiens (human)
endothelial cell activationTGF-beta receptor type-1Homo sapiens (human)
extracellular structure organizationTGF-beta receptor type-1Homo sapiens (human)
endothelial cell migrationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of DNA-templated transcriptionTGF-beta receptor type-1Homo sapiens (human)
filopodium assemblyTGF-beta receptor type-1Homo sapiens (human)
thymus developmentTGF-beta receptor type-1Homo sapiens (human)
neuron fate commitmentTGF-beta receptor type-1Homo sapiens (human)
embryonic cranial skeleton morphogenesisTGF-beta receptor type-1Homo sapiens (human)
skeletal system morphogenesisTGF-beta receptor type-1Homo sapiens (human)
mesenchymal cell differentiationTGF-beta receptor type-1Homo sapiens (human)
artery morphogenesisTGF-beta receptor type-1Homo sapiens (human)
cell motilityTGF-beta receptor type-1Homo sapiens (human)
positive regulation of filopodium assemblyTGF-beta receptor type-1Homo sapiens (human)
positive regulation of stress fiber assemblyTGF-beta receptor type-1Homo sapiens (human)
regulation of cell cycleTGF-beta receptor type-1Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionTGF-beta receptor type-1Homo sapiens (human)
parathyroid gland developmentTGF-beta receptor type-1Homo sapiens (human)
roof of mouth developmentTGF-beta receptor type-1Homo sapiens (human)
pharyngeal system developmentTGF-beta receptor type-1Homo sapiens (human)
regulation of cardiac muscle cell proliferationTGF-beta receptor type-1Homo sapiens (human)
cardiac epithelial to mesenchymal transitionTGF-beta receptor type-1Homo sapiens (human)
positive regulation of SMAD protein signal transductionTGF-beta receptor type-1Homo sapiens (human)
ventricular septum morphogenesisTGF-beta receptor type-1Homo sapiens (human)
angiogenesis involved in coronary vascular morphogenesisTGF-beta receptor type-1Homo sapiens (human)
coronary artery morphogenesisTGF-beta receptor type-1Homo sapiens (human)
response to cholesterolTGF-beta receptor type-1Homo sapiens (human)
cellular response to transforming growth factor beta stimulusTGF-beta receptor type-1Homo sapiens (human)
positive regulation of mesenchymal stem cell proliferationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of vasculature developmentTGF-beta receptor type-1Homo sapiens (human)
positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formationTGF-beta receptor type-1Homo sapiens (human)
positive regulation of tight junction disassemblyTGF-beta receptor type-1Homo sapiens (human)
epicardium morphogenesisTGF-beta receptor type-1Homo sapiens (human)
positive regulation of apoptotic signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathwayTGF-beta receptor type-1Homo sapiens (human)
protein phosphorylationTGF-beta receptor type-1Homo sapiens (human)
cellular response to growth factor stimulusTGF-beta receptor type-1Homo sapiens (human)
nervous system developmentTGF-beta receptor type-1Homo sapiens (human)
protein import into nucleusTyrosine-protein kinase SYKHomo sapiens (human)
regulation of DNA-binding transcription factor activityTyrosine-protein kinase SYKHomo sapiens (human)
angiogenesisTyrosine-protein kinase SYKHomo sapiens (human)
cell activationTyrosine-protein kinase SYKHomo sapiens (human)
lymph vessel developmentTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of receptor internalizationTyrosine-protein kinase SYKHomo sapiens (human)
stimulatory C-type lectin receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
adaptive immune responseTyrosine-protein kinase SYKHomo sapiens (human)
macrophage activation involved in immune responseTyrosine-protein kinase SYKHomo sapiens (human)
neutrophil activation involved in immune responseTyrosine-protein kinase SYKHomo sapiens (human)
leukocyte activation involved in immune responseTyrosine-protein kinase SYKHomo sapiens (human)
serotonin secretion by plateletTyrosine-protein kinase SYKHomo sapiens (human)
negative regulation of inflammatory response to antigenic stimulusTyrosine-protein kinase SYKHomo sapiens (human)
protein phosphorylationTyrosine-protein kinase SYKHomo sapiens (human)
leukocyte cell-cell adhesionTyrosine-protein kinase SYKHomo sapiens (human)
integrin-mediated signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
animal organ morphogenesisTyrosine-protein kinase SYKHomo sapiens (human)
regulation of platelet activationTyrosine-protein kinase SYKHomo sapiens (human)
regulation of tumor necrosis factor-mediated signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
peptidyl-tyrosine phosphorylationTyrosine-protein kinase SYKHomo sapiens (human)
leukotriene biosynthetic processTyrosine-protein kinase SYKHomo sapiens (human)
calcium-mediated signalingTyrosine-protein kinase SYKHomo sapiens (human)
platelet activationTyrosine-protein kinase SYKHomo sapiens (human)
B cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
neutrophil chemotaxisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of protein-containing complex assemblyTyrosine-protein kinase SYKHomo sapiens (human)
receptor internalizationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of type I interferon productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of granulocyte macrophage colony-stimulating factor productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-10 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-12 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-3 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-4 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-6 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of interleukin-8 productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of tumor necrosis factor productionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of mast cell cytokine productionTyrosine-protein kinase SYKHomo sapiens (human)
regulation of superoxide anion generationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of superoxide anion generationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of cell adhesion mediated by integrinTyrosine-protein kinase SYKHomo sapiens (human)
intracellular signal transductionTyrosine-protein kinase SYKHomo sapiens (human)
collagen-activated tyrosine kinase receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
Fc-epsilon receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
Fc-gamma receptor signaling pathway involved in phagocytosisTyrosine-protein kinase SYKHomo sapiens (human)
interleukin-3-mediated signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
gamma-delta T cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
defense response to bacteriumTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of cysteine-type endopeptidase activity involved in apoptotic processTyrosine-protein kinase SYKHomo sapiens (human)
mast cell degranulationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of mast cell degranulationTyrosine-protein kinase SYKHomo sapiens (human)
regulation of neutrophil degranulationTyrosine-protein kinase SYKHomo sapiens (human)
beta selectionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of MAPK cascadeTyrosine-protein kinase SYKHomo sapiens (human)
innate immune responseTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of B cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of gamma-delta T cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of bone resorptionTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of alpha-beta T cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of alpha-beta T cell proliferationTyrosine-protein kinase SYKHomo sapiens (human)
blood vessel morphogenesisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of peptidyl-tyrosine phosphorylationTyrosine-protein kinase SYKHomo sapiens (human)
regulation of phagocytosisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of calcium-mediated signalingTyrosine-protein kinase SYKHomo sapiens (human)
B cell receptor signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of killing of cells of another organismTyrosine-protein kinase SYKHomo sapiens (human)
regulation of ERK1 and ERK2 cascadeTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to molecule of fungal originTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to lipidTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to low-density lipoprotein particle stimulusTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of monocyte chemotactic protein-1 productionTyrosine-protein kinase SYKHomo sapiens (human)
regulation of arachidonic acid secretionTyrosine-protein kinase SYKHomo sapiens (human)
regulation of platelet aggregationTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of cold-induced thermogenesisTyrosine-protein kinase SYKHomo sapiens (human)
positive regulation of TORC1 signalingTyrosine-protein kinase SYKHomo sapiens (human)
cellular response to lectinTyrosine-protein kinase SYKHomo sapiens (human)
cell surface receptor protein tyrosine kinase signaling pathwayTyrosine-protein kinase SYKHomo sapiens (human)
cell differentiationTyrosine-protein kinase SYKHomo sapiens (human)
phosphorylationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
angiogenesisPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of cytokine productionPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
adaptive immune responsePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
dendritic cell chemotaxisPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of acute inflammatory responsePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
respiratory burst involved in defense responsePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
sphingosine-1-phosphate receptor signaling pathwayPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
endocytosisPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
inflammatory responsePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
immune responsePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
G protein-coupled receptor signaling pathwayPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
phospholipase C-activating G protein-coupled receptor signaling pathwayPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of cytosolic calcium ion concentrationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of endothelial cell migrationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
T cell chemotaxisPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
negative regulation of triglyceride catabolic processPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
neutrophil chemotaxisPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
secretory granule localizationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
regulation of cell adhesion mediated by integrinPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of Rac protein signal transductionPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
natural killer cell chemotaxisPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
T cell proliferationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
T cell activationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
mast cell degranulationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of MAP kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
phosphatidylinositol 3-kinase/protein kinase B signal transductionPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
innate immune responsePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
regulation of angiogenesisPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
phosphatidylinositol phosphate biosynthetic processPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transductionPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
negative regulation of cardiac muscle contractionPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
platelet aggregationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
cellular response to cAMPPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
neutrophil extravasationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
hepatocyte apoptotic processPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
regulation of calcium ion transmembrane transportPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
negative regulation of fibroblast apoptotic processPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
cell migrationPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
phosphatidylinositol-mediated signalingPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
phosphatidylinositol-3-phosphate biosynthetic processPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
positive regulation of gene expressionGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of gene expressionGlycogen synthase kinase-3 betaHomo sapiens (human)
ER overload responseGlycogen synthase kinase-3 betaHomo sapiens (human)
peptidyl-serine phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
intracellular signal transductionGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of apoptotic processGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein export from nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
epithelial to mesenchymal transitionGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of cell-matrix adhesionGlycogen synthase kinase-3 betaHomo sapiens (human)
glycogen metabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
protein phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
mitochondrion organizationGlycogen synthase kinase-3 betaHomo sapiens (human)
dopamine receptor signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
circadian rhythmGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of autophagyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of gene expressionGlycogen synthase kinase-3 betaHomo sapiens (human)
peptidyl-serine phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
peptidyl-threonine phosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
viral protein processingGlycogen synthase kinase-3 betaHomo sapiens (human)
hippocampus developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
establishment of cell polarityGlycogen synthase kinase-3 betaHomo sapiens (human)
maintenance of cell polarityGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of cell migrationGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of axon extensionGlycogen synthase kinase-3 betaHomo sapiens (human)
neuron projection developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of protein-containing complex assemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein-containing complex assemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein ubiquitinationGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of proteasomal ubiquitin-dependent protein catabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of phosphoprotein phosphatase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of microtubule-based processGlycogen synthase kinase-3 betaHomo sapiens (human)
intracellular signal transductionGlycogen synthase kinase-3 betaHomo sapiens (human)
cellular response to interleukin-3Glycogen synthase kinase-3 betaHomo sapiens (human)
regulation of circadian rhythmGlycogen synthase kinase-3 betaHomo sapiens (human)
proteasome-mediated ubiquitin-dependent protein catabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of GTPase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of cell differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of osteoblast differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of glycogen biosynthetic processGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of cilium assemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein catabolic processGlycogen synthase kinase-3 betaHomo sapiens (human)
protein autophosphorylationGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of protein export from nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of dendrite morphogenesisGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of axonogenesisGlycogen synthase kinase-3 betaHomo sapiens (human)
canonical Wnt signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
excitatory postsynaptic potentialGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of microtubule cytoskeleton organizationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of calcineurin-NFAT signaling cascadeGlycogen synthase kinase-3 betaHomo sapiens (human)
superior temporal gyrus developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
cellular response to retinoic acidGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of canonical Wnt signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
extrinsic apoptotic signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
extrinsic apoptotic signaling pathway in absence of ligandGlycogen synthase kinase-3 betaHomo sapiens (human)
presynaptic modulation of chemical synaptic transmissionGlycogen synthase kinase-3 betaHomo sapiens (human)
neuron projection organizationGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of microtubule anchoring at centrosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of cellular response to heatGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of protein localization to nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of long-term synaptic potentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of protein acetylationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of extrinsic apoptotic signaling pathway via death domain receptorsGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein localization to ciliumGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of dopaminergic neuron differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
cellular response to amyloid-betaGlycogen synthase kinase-3 betaHomo sapiens (human)
positive regulation of protein localization to centrosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
beta-catenin destruction complex disassemblyGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of type B pancreatic cell developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of glycogen (starch) synthase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of mesenchymal stem cell differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
negative regulation of TOR signalingGlycogen synthase kinase-3 betaHomo sapiens (human)
regulation of neuron projection developmentGlycogen synthase kinase-3 betaHomo sapiens (human)
cell differentiationGlycogen synthase kinase-3 betaHomo sapiens (human)
insulin receptor signaling pathwayGlycogen synthase kinase-3 betaHomo sapiens (human)
epithelial to mesenchymal transitionRho-associated protein kinase 1Homo sapiens (human)
aortic valve morphogenesisRho-associated protein kinase 1Homo sapiens (human)
apical constrictionRho-associated protein kinase 1Homo sapiens (human)
protein phosphorylationRho-associated protein kinase 1Homo sapiens (human)
smooth muscle contractionRho-associated protein kinase 1Homo sapiens (human)
leukocyte cell-cell adhesionRho-associated protein kinase 1Homo sapiens (human)
signal transductionRho-associated protein kinase 1Homo sapiens (human)
canonical NF-kappaB signal transductionRho-associated protein kinase 1Homo sapiens (human)
Rho protein signal transductionRho-associated protein kinase 1Homo sapiens (human)
positive regulation of autophagyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of cardiac muscle hypertrophyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of gene expressionRho-associated protein kinase 1Homo sapiens (human)
positive regulation of phosphatase activityRho-associated protein kinase 1Homo sapiens (human)
negative regulation of angiogenesisRho-associated protein kinase 1Homo sapiens (human)
peptidyl-serine phosphorylationRho-associated protein kinase 1Homo sapiens (human)
membrane to membrane dockingRho-associated protein kinase 1Homo sapiens (human)
actin cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
regulation of cell adhesionRho-associated protein kinase 1Homo sapiens (human)
regulation of cell migrationRho-associated protein kinase 1Homo sapiens (human)
cortical actin cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
neuron projection developmentRho-associated protein kinase 1Homo sapiens (human)
bleb assemblyRho-associated protein kinase 1Homo sapiens (human)
negative regulation of protein bindingRho-associated protein kinase 1Homo sapiens (human)
regulation of actin cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
positive regulation of dephosphorylationRho-associated protein kinase 1Homo sapiens (human)
negative regulation of myosin-light-chain-phosphatase activityRho-associated protein kinase 1Homo sapiens (human)
negative regulation of phosphorylationRho-associated protein kinase 1Homo sapiens (human)
positive regulation of MAPK cascadeRho-associated protein kinase 1Homo sapiens (human)
regulation of keratinocyte differentiationRho-associated protein kinase 1Homo sapiens (human)
regulation of neuron differentiationRho-associated protein kinase 1Homo sapiens (human)
leukocyte migrationRho-associated protein kinase 1Homo sapiens (human)
leukocyte tethering or rollingRho-associated protein kinase 1Homo sapiens (human)
negative regulation of membrane protein ectodomain proteolysisRho-associated protein kinase 1Homo sapiens (human)
myoblast migrationRho-associated protein kinase 1Homo sapiens (human)
regulation of stress fiber assemblyRho-associated protein kinase 1Homo sapiens (human)
regulation of focal adhesion assemblyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of focal adhesion assemblyRho-associated protein kinase 1Homo sapiens (human)
mRNA destabilizationRho-associated protein kinase 1Homo sapiens (human)
negative regulation of biomineral tissue developmentRho-associated protein kinase 1Homo sapiens (human)
regulation of microtubule cytoskeleton organizationRho-associated protein kinase 1Homo sapiens (human)
response to transforming growth factor betaRho-associated protein kinase 1Homo sapiens (human)
protein localization to plasma membraneRho-associated protein kinase 1Homo sapiens (human)
regulation of synapse maturationRho-associated protein kinase 1Homo sapiens (human)
podocyte cell migrationRho-associated protein kinase 1Homo sapiens (human)
motor neuron apoptotic processRho-associated protein kinase 1Homo sapiens (human)
blood vessel diameter maintenanceRho-associated protein kinase 1Homo sapiens (human)
regulation of angiotensin-activated signaling pathwayRho-associated protein kinase 1Homo sapiens (human)
neuron projection arborizationRho-associated protein kinase 1Homo sapiens (human)
positive regulation of amyloid-beta clearanceRho-associated protein kinase 1Homo sapiens (human)
regulation of synaptic vesicle endocytosisRho-associated protein kinase 1Homo sapiens (human)
negative regulation of amyloid-beta formationRho-associated protein kinase 1Homo sapiens (human)
negative regulation of amyloid precursor protein catabolic processRho-associated protein kinase 1Homo sapiens (human)
regulation of establishment of endothelial barrierRho-associated protein kinase 1Homo sapiens (human)
negative regulation of bicellular tight junction assemblyRho-associated protein kinase 1Homo sapiens (human)
positive regulation of connective tissue replacementRho-associated protein kinase 1Homo sapiens (human)
response to angiotensinRho-associated protein kinase 1Homo sapiens (human)
regulation of establishment of cell polarityRho-associated protein kinase 1Homo sapiens (human)
regulation of cell motilityRho-associated protein kinase 1Homo sapiens (human)
negative regulation of motor neuron apoptotic processRho-associated protein kinase 1Homo sapiens (human)
regulation of cell junction assemblyRho-associated protein kinase 1Homo sapiens (human)
mitotic cytokinesisRho-associated protein kinase 1Homo sapiens (human)
embryonic morphogenesisRho-associated protein kinase 1Homo sapiens (human)
peptidyl-threonine phosphorylationRho-associated protein kinase 1Homo sapiens (human)
actomyosin structure organizationRho-associated protein kinase 1Homo sapiens (human)
glucose metabolic process[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
cell population proliferation[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
intrinsic apoptotic signaling pathway in response to oxidative stress[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
regulation of acetyl-CoA biosynthetic process from pyruvate[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
regulation of glucose metabolic process[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
hypoxia-inducible factor-1alpha signaling pathway[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
protein phosphorylation[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
G protein-coupled receptor signaling pathwayGrowth hormone secretagogue receptor type 1Homo sapiens (human)
spermatogenesisGrowth hormone secretagogue receptor type 1Homo sapiens (human)
learning or memoryGrowth hormone secretagogue receptor type 1Homo sapiens (human)
actin polymerization or depolymerizationGrowth hormone secretagogue receptor type 1Homo sapiens (human)
adult feeding behaviorGrowth hormone secretagogue receptor type 1Homo sapiens (human)
response to hormoneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
hormone-mediated signaling pathwayGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of norepinephrine secretionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
growth hormone secretionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
response to foodGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of appetiteGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of appetiteGrowth hormone secretagogue receptor type 1Homo sapiens (human)
response to follicle-stimulating hormoneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
response to estradiolGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of interleukin-1 beta productionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of interleukin-6 productionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of tumor necrosis factor productionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
cellular response to insulin stimulusGrowth hormone secretagogue receptor type 1Homo sapiens (human)
ghrelin secretionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of multicellular organism growthGrowth hormone secretagogue receptor type 1Homo sapiens (human)
regulation of hindgut contractionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of insulin-like growth factor receptor signaling pathwayGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of fatty acid metabolic processGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of insulin secretionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
decidualizationGrowth hormone secretagogue receptor type 1Homo sapiens (human)
insulin-like growth factor receptor signaling pathwayGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of inflammatory responseGrowth hormone secretagogue receptor type 1Homo sapiens (human)
regulation of synapse assemblyGrowth hormone secretagogue receptor type 1Homo sapiens (human)
regulation of transmission of nerve impulseGrowth hormone secretagogue receptor type 1Homo sapiens (human)
regulation of growth hormone secretionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
response to growth hormoneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
cellular response to lipopolysaccharideGrowth hormone secretagogue receptor type 1Homo sapiens (human)
response to dexamethasoneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of locomotion involved in locomotory behaviorGrowth hormone secretagogue receptor type 1Homo sapiens (human)
cellular response to thyroid hormone stimulusGrowth hormone secretagogue receptor type 1Homo sapiens (human)
regulation of neurotransmitter receptor localization to postsynaptic specialization membraneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
postsynaptic modulation of chemical synaptic transmissionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
regulation of postsynapse organizationGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of small intestinal transitGrowth hormone secretagogue receptor type 1Homo sapiens (human)
response to L-glutamateGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of sprouting angiogenesisGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of eating behaviorGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of small intestine smooth muscle contractionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
regulation of gastric motilityGrowth hormone secretagogue receptor type 1Homo sapiens (human)
positive regulation of vascular endothelial cell proliferationGrowth hormone secretagogue receptor type 1Homo sapiens (human)
cellular response to insulin-like growth factor stimulusGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of macrophage apoptotic processGrowth hormone secretagogue receptor type 1Homo sapiens (human)
negative regulation of transcription by RNA polymerase IIAurora kinase BHomo sapiens (human)
mitotic cell cycleAurora kinase BHomo sapiens (human)
mitotic cytokinesisAurora kinase BHomo sapiens (human)
negative regulation of B cell apoptotic processAurora kinase BHomo sapiens (human)
protein phosphorylationAurora kinase BHomo sapiens (human)
spindle organizationAurora kinase BHomo sapiens (human)
attachment of spindle microtubules to kinetochoreAurora kinase BHomo sapiens (human)
abscissionAurora kinase BHomo sapiens (human)
negative regulation of protein bindingAurora kinase BHomo sapiens (human)
positive regulation of telomere maintenance via telomeraseAurora kinase BHomo sapiens (human)
negative regulation of cytokinesisAurora kinase BHomo sapiens (human)
positive regulation of cytokinesisAurora kinase BHomo sapiens (human)
protein localization to kinetochoreAurora kinase BHomo sapiens (human)
cellular response to UVAurora kinase BHomo sapiens (human)
cleavage furrow formationAurora kinase BHomo sapiens (human)
post-translational protein modificationAurora kinase BHomo sapiens (human)
cell cycle G2/M phase transitionAurora kinase BHomo sapiens (human)
mitotic cytokinesis checkpoint signalingAurora kinase BHomo sapiens (human)
negative regulation of innate immune responseAurora kinase BHomo sapiens (human)
protein autophosphorylationAurora kinase BHomo sapiens (human)
mitotic spindle midzone assemblyAurora kinase BHomo sapiens (human)
positive regulation of telomerase activityAurora kinase BHomo sapiens (human)
regulation of chromosome segregationAurora kinase BHomo sapiens (human)
positive regulation of mitotic sister chromatid segregationAurora kinase BHomo sapiens (human)
positive regulation of mitotic cell cycle spindle assembly checkpointAurora kinase BHomo sapiens (human)
mitotic spindle assemblyAurora kinase BHomo sapiens (human)
negative regulation of cGAS/STING signaling pathwayAurora kinase BHomo sapiens (human)
regulation of signal transduction by p53 class mediatorAurora kinase BHomo sapiens (human)
positive regulation of mitotic sister chromatid separationAurora kinase BHomo sapiens (human)
positive regulation of attachment of mitotic spindle microtubules to kinetochoreAurora kinase BHomo sapiens (human)
positive regulation of mitotic cytokinesisAurora kinase BHomo sapiens (human)
positive regulation of telomere cappingAurora kinase BHomo sapiens (human)
positive regulation of lateral attachment of mitotic spindle microtubules to kinetochoreAurora kinase BHomo sapiens (human)
mitotic spindle organizationAurora kinase BHomo sapiens (human)
regulation of cytokinesisAurora kinase BHomo sapiens (human)
MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
response to ischemiaMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein phosphorylationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
JNK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to oxidative stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of cardiac muscle cell apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to amino acid starvationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
response to endoplasmic reticulum stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
neuron intrinsic apoptotic signaling pathway in response to oxidative stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
p38MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of cysteine-type endopeptidase activity involved in apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of JUN kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
innate immune responseMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of myoblast differentiationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of protein kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of DNA-templated transcriptionMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of JNK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
neuron apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
stress-activated MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to hydrogen peroxideMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to tumor necrosis factorMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
endothelial cell apoptotic processMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular senescenceMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
apoptotic signaling pathwayMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
programmed necrotic cell deathMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of p38MAPK cascadeMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to reactive nitrogen speciesMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
positive regulation of vascular associated smooth muscle cell proliferationMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cellular response to stressMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Molecular Functions (95)

Processvia Protein(s)Taxonomy
protein kinase activityAurora kinase AHomo sapiens (human)
protein serine/threonine kinase activityAurora kinase AHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityAurora kinase AHomo sapiens (human)
protein bindingAurora kinase AHomo sapiens (human)
ATP bindingAurora kinase AHomo sapiens (human)
protein kinase bindingAurora kinase AHomo sapiens (human)
ubiquitin protein ligase bindingAurora kinase AHomo sapiens (human)
histone H3S10 kinase activityAurora kinase AHomo sapiens (human)
protein heterodimerization activityAurora kinase AHomo sapiens (human)
protein serine kinase activityAurora kinase AHomo sapiens (human)
molecular function activator activityAurora kinase AHomo sapiens (human)
protein kinase activityInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
protein serine/threonine kinase activityInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
protein bindingInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
ATP bindingInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
IkappaB kinase activityInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
protein homodimerization activityInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
protein-containing complex bindingInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
protein heterodimerization activityInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
scaffold protein bindingInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
transferrin receptor bindingInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
protein serine/threonine kinase activity3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
3-phosphoinositide-dependent protein kinase activity3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
protein binding3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
ATP binding3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
phospholipase activator activity3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
phospholipase binding3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
protein serine kinase activity3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
epidermal growth factor receptor activityEpidermal growth factor receptorHomo sapiens (human)
virus receptor activityEpidermal growth factor receptorHomo sapiens (human)
chromatin bindingEpidermal growth factor receptorHomo sapiens (human)
double-stranded DNA bindingEpidermal growth factor receptorHomo sapiens (human)
MAP kinase kinase kinase activityEpidermal growth factor receptorHomo sapiens (human)
protein tyrosine kinase activityEpidermal growth factor receptorHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activityEpidermal growth factor receptorHomo sapiens (human)
transmembrane signaling receptor activityEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor receptor activityEpidermal growth factor receptorHomo sapiens (human)
integrin bindingEpidermal growth factor receptorHomo sapiens (human)
protein bindingEpidermal growth factor receptorHomo sapiens (human)
calmodulin bindingEpidermal growth factor receptorHomo sapiens (human)
ATP bindingEpidermal growth factor receptorHomo sapiens (human)
enzyme bindingEpidermal growth factor receptorHomo sapiens (human)
kinase bindingEpidermal growth factor receptorHomo sapiens (human)
protein kinase bindingEpidermal growth factor receptorHomo sapiens (human)
protein phosphatase bindingEpidermal growth factor receptorHomo sapiens (human)
protein tyrosine kinase activator activityEpidermal growth factor receptorHomo sapiens (human)
transmembrane receptor protein tyrosine kinase activator activityEpidermal growth factor receptorHomo sapiens (human)
ubiquitin protein ligase bindingEpidermal growth factor receptorHomo sapiens (human)
identical protein bindingEpidermal growth factor receptorHomo sapiens (human)
cadherin bindingEpidermal growth factor receptorHomo sapiens (human)
actin filament bindingEpidermal growth factor receptorHomo sapiens (human)
ATPase bindingEpidermal growth factor receptorHomo sapiens (human)
epidermal growth factor bindingEpidermal growth factor receptorHomo sapiens (human)
cytokine activityInterferon betaHomo sapiens (human)
cytokine receptor bindingInterferon betaHomo sapiens (human)
type I interferon receptor bindingInterferon betaHomo sapiens (human)
protein bindingInterferon betaHomo sapiens (human)
chloramphenicol O-acetyltransferase activityInterferon betaHomo sapiens (human)
protein kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
calmodulin bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
ATP bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphatidylinositol-3,4,5-trisphosphate bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
enzyme bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein kinase bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nitric-oxide synthase regulator activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine/threonine kinase inhibitor activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
identical protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein homodimerization activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
phosphatidylinositol-3,4-bisphosphate bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
14-3-3 protein bindingRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
potassium channel activator activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein serine kinase activityRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein tyrosine kinase activityVascular endothelial growth factor receptor 2Homo sapiens (human)
transmembrane receptor protein tyrosine kinase activityVascular endothelial growth factor receptor 2Homo sapiens (human)
vascular endothelial growth factor receptor activityVascular endothelial growth factor receptor 2Homo sapiens (human)
integrin bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
protein bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
ATP bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
coreceptor activityVascular endothelial growth factor receptor 2Homo sapiens (human)
growth factor bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
vascular endothelial growth factor bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
identical protein bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
cadherin bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
Hsp90 protein bindingVascular endothelial growth factor receptor 2Homo sapiens (human)
transforming growth factor beta receptor activityTGF-beta receptor type-1Homo sapiens (human)
growth factor bindingTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta bindingTGF-beta receptor type-1Homo sapiens (human)
protein kinase activityTGF-beta receptor type-1Homo sapiens (human)
protein serine/threonine kinase activityTGF-beta receptor type-1Homo sapiens (human)
transmembrane receptor protein serine/threonine kinase activityTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta receptor activityTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta receptor activity, type ITGF-beta receptor type-1Homo sapiens (human)
type II transforming growth factor beta receptor bindingTGF-beta receptor type-1Homo sapiens (human)
protein bindingTGF-beta receptor type-1Homo sapiens (human)
ATP bindingTGF-beta receptor type-1Homo sapiens (human)
ubiquitin protein ligase bindingTGF-beta receptor type-1Homo sapiens (human)
SMAD bindingTGF-beta receptor type-1Homo sapiens (human)
metal ion bindingTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta bindingTGF-beta receptor type-1Homo sapiens (human)
I-SMAD bindingTGF-beta receptor type-1Homo sapiens (human)
activin receptor activity, type ITGF-beta receptor type-1Homo sapiens (human)
activin bindingTGF-beta receptor type-1Homo sapiens (human)
phosphotyrosine residue bindingTyrosine-protein kinase SYKHomo sapiens (human)
protein kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
protein serine/threonine kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
protein tyrosine kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
non-membrane spanning protein tyrosine kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
signaling receptor bindingTyrosine-protein kinase SYKHomo sapiens (human)
integrin bindingTyrosine-protein kinase SYKHomo sapiens (human)
protein bindingTyrosine-protein kinase SYKHomo sapiens (human)
ATP bindingTyrosine-protein kinase SYKHomo sapiens (human)
interleukin-15 receptor bindingTyrosine-protein kinase SYKHomo sapiens (human)
kinase activityTyrosine-protein kinase SYKHomo sapiens (human)
protein kinase bindingTyrosine-protein kinase SYKHomo sapiens (human)
phosphatase bindingTyrosine-protein kinase SYKHomo sapiens (human)
Toll-like receptor bindingTyrosine-protein kinase SYKHomo sapiens (human)
SH2 domain bindingTyrosine-protein kinase SYKHomo sapiens (human)
phospholipase bindingTyrosine-protein kinase SYKHomo sapiens (human)
scaffold protein bindingTyrosine-protein kinase SYKHomo sapiens (human)
protein kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
protein serine/threonine kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
protein bindingPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
ATP bindingPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
1-phosphatidylinositol-3-kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
1-phosphatidylinositol-4-phosphate 3-kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
identical protein bindingPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
ephrin receptor bindingPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
1-phosphatidylinositol-4,5-bisphosphate 3-kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
protein serine kinase activityPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
protease bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
p53 bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein serine/threonine kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
ATP bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
beta-catenin bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
ubiquitin protein ligase bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase A catalytic subunit bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
dynactin bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
tau protein bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
tau-protein kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
NF-kappaB bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
RNA polymerase II-specific DNA-binding transcription factor bindingGlycogen synthase kinase-3 betaHomo sapiens (human)
protein serine kinase activityGlycogen synthase kinase-3 betaHomo sapiens (human)
protein kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein serine/threonine kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein bindingRho-associated protein kinase 1Homo sapiens (human)
ATP bindingRho-associated protein kinase 1Homo sapiens (human)
small GTPase bindingRho-associated protein kinase 1Homo sapiens (human)
metal ion bindingRho-associated protein kinase 1Homo sapiens (human)
tau protein bindingRho-associated protein kinase 1Homo sapiens (human)
tau-protein kinase activityRho-associated protein kinase 1Homo sapiens (human)
Rho-dependent protein serine/threonine kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein serine kinase activityRho-associated protein kinase 1Homo sapiens (human)
protein kinase activity[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
pyruvate dehydrogenase (acetyl-transferring) kinase activity[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
protein binding[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
ATP binding[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
growth hormone secretagogue receptor activityGrowth hormone secretagogue receptor type 1Homo sapiens (human)
G protein-coupled receptor activityGrowth hormone secretagogue receptor type 1Homo sapiens (human)
growth hormone-releasing hormone receptor activityGrowth hormone secretagogue receptor type 1Homo sapiens (human)
peptide hormone bindingGrowth hormone secretagogue receptor type 1Homo sapiens (human)
protein serine/threonine kinase activityAurora kinase BHomo sapiens (human)
protein serine/threonine kinase activityAurora kinase BHomo sapiens (human)
protein serine/threonine/tyrosine kinase activityAurora kinase BHomo sapiens (human)
protein bindingAurora kinase BHomo sapiens (human)
ATP bindingAurora kinase BHomo sapiens (human)
kinase bindingAurora kinase BHomo sapiens (human)
protein serine kinase activityAurora kinase BHomo sapiens (human)
magnesium ion bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein serine/threonine kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
JUN kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
MAP kinase kinase kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
ATP bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein kinase bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein phosphatase bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein domain specific bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
identical protein bindingMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein homodimerization activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein serine kinase activityMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Ceullar Components (93)

Processvia Protein(s)Taxonomy
spindle microtubuleAurora kinase AHomo sapiens (human)
nucleusAurora kinase AHomo sapiens (human)
nucleoplasmAurora kinase AHomo sapiens (human)
centrosomeAurora kinase AHomo sapiens (human)
centrioleAurora kinase AHomo sapiens (human)
spindleAurora kinase AHomo sapiens (human)
cytosolAurora kinase AHomo sapiens (human)
postsynaptic densityAurora kinase AHomo sapiens (human)
microtubule cytoskeletonAurora kinase AHomo sapiens (human)
basolateral plasma membraneAurora kinase AHomo sapiens (human)
midbodyAurora kinase AHomo sapiens (human)
spindle pole centrosomeAurora kinase AHomo sapiens (human)
ciliary basal bodyAurora kinase AHomo sapiens (human)
germinal vesicleAurora kinase AHomo sapiens (human)
axon hillockAurora kinase AHomo sapiens (human)
pronucleusAurora kinase AHomo sapiens (human)
perinuclear region of cytoplasmAurora kinase AHomo sapiens (human)
mitotic spindleAurora kinase AHomo sapiens (human)
meiotic spindleAurora kinase AHomo sapiens (human)
mitotic spindle poleAurora kinase AHomo sapiens (human)
glutamatergic synapseAurora kinase AHomo sapiens (human)
spindle pole centrosomeAurora kinase AHomo sapiens (human)
chromosome passenger complexAurora kinase AHomo sapiens (human)
spindle midzoneAurora kinase AHomo sapiens (human)
kinetochoreAurora kinase AHomo sapiens (human)
nucleoplasmInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cytoplasmInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cytosolInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
IkappaB kinase complexInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cytoplasmic side of plasma membraneInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
CD40 receptor complexInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
cytoplasmInhibitor of nuclear factor kappa-B kinase subunit alphaHomo sapiens (human)
nucleus3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cytoplasm3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cytosol3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
plasma membrane3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
focal adhesion3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
postsynaptic density3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cytoplasmic vesicle3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
cell projection3-phosphoinositide-dependent protein kinase 1Homo sapiens (human)
endosomeEpidermal growth factor receptorHomo sapiens (human)
plasma membraneEpidermal growth factor receptorHomo sapiens (human)
ruffle membraneEpidermal growth factor receptorHomo sapiens (human)
Golgi membraneEpidermal growth factor receptorHomo sapiens (human)
extracellular spaceEpidermal growth factor receptorHomo sapiens (human)
nucleusEpidermal growth factor receptorHomo sapiens (human)
cytoplasmEpidermal growth factor receptorHomo sapiens (human)
endosomeEpidermal growth factor receptorHomo sapiens (human)
endoplasmic reticulum membraneEpidermal growth factor receptorHomo sapiens (human)
plasma membraneEpidermal growth factor receptorHomo sapiens (human)
focal adhesionEpidermal growth factor receptorHomo sapiens (human)
cell surfaceEpidermal growth factor receptorHomo sapiens (human)
endosome membraneEpidermal growth factor receptorHomo sapiens (human)
membraneEpidermal growth factor receptorHomo sapiens (human)
basolateral plasma membraneEpidermal growth factor receptorHomo sapiens (human)
apical plasma membraneEpidermal growth factor receptorHomo sapiens (human)
cell junctionEpidermal growth factor receptorHomo sapiens (human)
clathrin-coated endocytic vesicle membraneEpidermal growth factor receptorHomo sapiens (human)
early endosome membraneEpidermal growth factor receptorHomo sapiens (human)
nuclear membraneEpidermal growth factor receptorHomo sapiens (human)
membrane raftEpidermal growth factor receptorHomo sapiens (human)
perinuclear region of cytoplasmEpidermal growth factor receptorHomo sapiens (human)
multivesicular body, internal vesicle lumenEpidermal growth factor receptorHomo sapiens (human)
intracellular vesicleEpidermal growth factor receptorHomo sapiens (human)
protein-containing complexEpidermal growth factor receptorHomo sapiens (human)
receptor complexEpidermal growth factor receptorHomo sapiens (human)
Shc-EGFR complexEpidermal growth factor receptorHomo sapiens (human)
basal plasma membraneEpidermal growth factor receptorHomo sapiens (human)
extracellular spaceInterferon betaHomo sapiens (human)
extracellular regionInterferon betaHomo sapiens (human)
cytoplasmRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
mitochondrial intermembrane spaceRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nucleusRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
nucleoplasmRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cytoplasmRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
spindleRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cytosolRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
plasma membraneRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell-cell junctionRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
cell cortexRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
microtubule cytoskeletonRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
lamellipodiumRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
vesicleRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
ciliary basal bodyRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
postsynapseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
glutamatergic synapseRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
protein-containing complexRAC-alpha serine/threonine-protein kinaseHomo sapiens (human)
extracellular regionVascular endothelial growth factor receptor 2Homo sapiens (human)
nucleusVascular endothelial growth factor receptor 2Homo sapiens (human)
endosomeVascular endothelial growth factor receptor 2Homo sapiens (human)
early endosomeVascular endothelial growth factor receptor 2Homo sapiens (human)
endoplasmic reticulumVascular endothelial growth factor receptor 2Homo sapiens (human)
Golgi apparatusVascular endothelial growth factor receptor 2Homo sapiens (human)
plasma membraneVascular endothelial growth factor receptor 2Homo sapiens (human)
external side of plasma membraneVascular endothelial growth factor receptor 2Homo sapiens (human)
cell junctionVascular endothelial growth factor receptor 2Homo sapiens (human)
membrane raftVascular endothelial growth factor receptor 2Homo sapiens (human)
anchoring junctionVascular endothelial growth factor receptor 2Homo sapiens (human)
sorting endosomeVascular endothelial growth factor receptor 2Homo sapiens (human)
plasma membraneVascular endothelial growth factor receptor 2Homo sapiens (human)
receptor complexVascular endothelial growth factor receptor 2Homo sapiens (human)
nucleusTGF-beta receptor type-1Homo sapiens (human)
endosomeTGF-beta receptor type-1Homo sapiens (human)
plasma membraneTGF-beta receptor type-1Homo sapiens (human)
bicellular tight junctionTGF-beta receptor type-1Homo sapiens (human)
cell surfaceTGF-beta receptor type-1Homo sapiens (human)
membrane raftTGF-beta receptor type-1Homo sapiens (human)
transforming growth factor beta ligand-receptor complexTGF-beta receptor type-1Homo sapiens (human)
receptor complexTGF-beta receptor type-1Homo sapiens (human)
plasma membraneTGF-beta receptor type-1Homo sapiens (human)
activin receptor complexTGF-beta receptor type-1Homo sapiens (human)
cytoplasmTyrosine-protein kinase SYKHomo sapiens (human)
nucleusTyrosine-protein kinase SYKHomo sapiens (human)
cytoplasmTyrosine-protein kinase SYKHomo sapiens (human)
cytosolTyrosine-protein kinase SYKHomo sapiens (human)
plasma membraneTyrosine-protein kinase SYKHomo sapiens (human)
early phagosomeTyrosine-protein kinase SYKHomo sapiens (human)
B cell receptor complexTyrosine-protein kinase SYKHomo sapiens (human)
protein-containing complexTyrosine-protein kinase SYKHomo sapiens (human)
T cell receptor complexTyrosine-protein kinase SYKHomo sapiens (human)
plasma membraneTyrosine-protein kinase SYKHomo sapiens (human)
cytoplasmPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
cytosolPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
plasma membranePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
phosphatidylinositol 3-kinase complex, class IAPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
membranePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
phosphatidylinositol 3-kinase complex, class IBPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
plasma membranePhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
cytoplasmPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Homo sapiens (human)
glutamatergic synapseGlycogen synthase kinase-3 betaHomo sapiens (human)
nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
nucleoplasmGlycogen synthase kinase-3 betaHomo sapiens (human)
cytoplasmGlycogen synthase kinase-3 betaHomo sapiens (human)
mitochondrionGlycogen synthase kinase-3 betaHomo sapiens (human)
centrosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
cytosolGlycogen synthase kinase-3 betaHomo sapiens (human)
plasma membraneGlycogen synthase kinase-3 betaHomo sapiens (human)
axonGlycogen synthase kinase-3 betaHomo sapiens (human)
dendriteGlycogen synthase kinase-3 betaHomo sapiens (human)
beta-catenin destruction complexGlycogen synthase kinase-3 betaHomo sapiens (human)
presynapseGlycogen synthase kinase-3 betaHomo sapiens (human)
postsynapseGlycogen synthase kinase-3 betaHomo sapiens (human)
Wnt signalosomeGlycogen synthase kinase-3 betaHomo sapiens (human)
cytosolGlycogen synthase kinase-3 betaHomo sapiens (human)
axonGlycogen synthase kinase-3 betaHomo sapiens (human)
nucleusGlycogen synthase kinase-3 betaHomo sapiens (human)
cytoplasmGlycogen synthase kinase-3 betaHomo sapiens (human)
Golgi membraneRho-associated protein kinase 1Homo sapiens (human)
ruffleRho-associated protein kinase 1Homo sapiens (human)
extracellular regionRho-associated protein kinase 1Homo sapiens (human)
centrioleRho-associated protein kinase 1Homo sapiens (human)
cytosolRho-associated protein kinase 1Homo sapiens (human)
cytoskeletonRho-associated protein kinase 1Homo sapiens (human)
plasma membraneRho-associated protein kinase 1Homo sapiens (human)
cytoplasmic stress granuleRho-associated protein kinase 1Homo sapiens (human)
lamellipodiumRho-associated protein kinase 1Homo sapiens (human)
blebRho-associated protein kinase 1Homo sapiens (human)
secretory granule lumenRho-associated protein kinase 1Homo sapiens (human)
Schaffer collateral - CA1 synapseRho-associated protein kinase 1Homo sapiens (human)
cytoskeletonRho-associated protein kinase 1Homo sapiens (human)
cytoplasmRho-associated protein kinase 1Homo sapiens (human)
cytoplasmic stress granuleRho-associated protein kinase 1Homo sapiens (human)
mitochondrial matrix[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
mitochondrion[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrialHomo sapiens (human)
plasma membraneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
cell surfaceGrowth hormone secretagogue receptor type 1Homo sapiens (human)
neuron projectionGrowth hormone secretagogue receptor type 1Homo sapiens (human)
membrane raftGrowth hormone secretagogue receptor type 1Homo sapiens (human)
synaptic membraneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
Schaffer collateral - CA1 synapseGrowth hormone secretagogue receptor type 1Homo sapiens (human)
postsynapseGrowth hormone secretagogue receptor type 1Homo sapiens (human)
glutamatergic synapseGrowth hormone secretagogue receptor type 1Homo sapiens (human)
plasma membraneGrowth hormone secretagogue receptor type 1Homo sapiens (human)
kinetochoreAurora kinase BHomo sapiens (human)
condensed chromosome, centromeric regionAurora kinase BHomo sapiens (human)
nucleusAurora kinase BHomo sapiens (human)
nucleoplasmAurora kinase BHomo sapiens (human)
spindleAurora kinase BHomo sapiens (human)
cytosolAurora kinase BHomo sapiens (human)
chromocenterAurora kinase BHomo sapiens (human)
microtubule cytoskeletonAurora kinase BHomo sapiens (human)
midbodyAurora kinase BHomo sapiens (human)
chromosome passenger complexAurora kinase BHomo sapiens (human)
mitotic spindle poleAurora kinase BHomo sapiens (human)
mitotic spindle midzoneAurora kinase BHomo sapiens (human)
kinetochoreAurora kinase BHomo sapiens (human)
spindle pole centrosomeAurora kinase BHomo sapiens (human)
spindle microtubuleAurora kinase BHomo sapiens (human)
spindle midzoneAurora kinase BHomo sapiens (human)
cytoplasmMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
cytosolMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
external side of plasma membraneMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein-containing complexMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
protein kinase complexMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
IRE1-TRAF2-ASK1 complexMitogen-activated protein kinase kinase kinase 5Homo sapiens (human)
[Information is prepared from geneontology information from the June-17-2024 release]

Bioassays (72)

Assay IDTitleYearJournalArticle
AID1347412qHTS assay to identify inhibitors of the type 1 interferon - major histocompatibility complex class I in skeletal muscle: Counter screen cell viability and HiBit confirmation2020ACS chemical biology, 07-17, Volume: 15, Issue:7
High-Throughput Screening to Identify Inhibitors of the Type I Interferon-Major Histocompatibility Complex Class I Pathway in Skeletal Muscle.
AID1645871NCATS Parallel Artificial Membrane Permeability Assay (PAMPA) Profiling in pH 5 buffer2022Bioorganic & medicinal chemistry, 02-15, Volume: 56Using in vitro ADME data for lead compound selection: An emphasis on PAMPA pH 5 permeability and oral bioavailability.
AID1645848NCATS Kinetic Aqueous Solubility Profiling2019Bioorganic & medicinal chemistry, 07-15, Volume: 27, Issue:14
Predictive models of aqueous solubility of organic compounds built on A large dataset of high integrity.
AID1347411qHTS to identify inhibitors of the type 1 interferon - major histocompatibility complex class I in skeletal muscle: primary screen against the NCATS Mechanism Interrogation Plate v5.0 (MIPE) Libary2020ACS chemical biology, 07-17, Volume: 15, Issue:7
High-Throughput Screening to Identify Inhibitors of the Type I Interferon-Major Histocompatibility Complex Class I Pathway in Skeletal Muscle.
AID592261Inhibition of human SGK assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592285Inhibition of PI3Kgamma2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592290Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human OCI-AML-2 cells xenografted in SCID mouse at 100 mg/kg, ip after 6 hrs by LC/MS/MS analysis2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592267Inhibition of human ROCK2 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592286Inhibition of SYK2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592350Selectivity ratio of IC50 for AKT1 to IC50 for ALK52011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592277Inhibition of human RET assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592278Inhibition of human RSK1 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592289Cmax in SCID mouse xenografted with human OCI-AML-2 cells at 100 mg/kg, ip administered as a single dose by LC/MS/MS analysis2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592347Inhibition of PDK1-mediated RSK phosphorylation at Ser221 residue in human OCI-AML-2 cells xenografted in SCID mouse at 100 mg/kg, ip after 6 hrs by LC/MS/MS analysis2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592291Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human OCI-AML-2 cells xenografted in SCID mouse at 100 mg/kg, ip after 3 hrs by LC/MS/MS analysis2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592181Inhibition of ALK52011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592360Selectivity ratio of IC50 for AKT1 to IC50 for VEGFR22011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592271Inhibition of human BRSK1 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID641893Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence-based spectrophotometry2011Journal of medicinal chemistry, Dec-22, Volume: 54, Issue:24
Discovery of novel, potent, and selective inhibitors of 3-phosphoinositide-dependent kinase (PDK1).
AID592287Inhibition of VEGFR22011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592352Selectivity ratio of IC50 for AKT1 to IC50 for aurora A2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592184Inhibition of PDK1-mediated RSK phosphorylation at Ser221 residue in human PC3 cells by ELISA2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592187Antiproliferative activity against human OCI-AML2 cells2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592265Inhibition of human PKBgamma assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592180Inhibition of aurora B2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592276Inhibition of human aurora-B assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592190Antiproliferative activity against human F-36P cells2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592262Inhibition of human ARK5 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592274Inhibition of human MET D1246H mutant assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592279Inhibition of human MET Y1248H assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592355Selectivity ratio of IC50 for AKT1 to IC50 for GSK3-beta2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592182Inhibition of ROCK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592275Inhibition of human BRSK2 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592358Selectivity ratio of IC50 for AKT1 to IC50 for ROCK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592178Inhibition of PDK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592348Inhibition of human RSK3 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592356Selectivity ratio of IC50 for AKT1 to IC50 for IKK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592351Selectivity ratio of IC50 for AKT1 to IC50 for ASK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID729481Inhibition of recombinant full length PDK1 (unknown origin) expressed in insect cells assessed as inhibition of Akt activation measured for 30 mins in presence of [gamma32P-ATP]2013Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1.
AID592183Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human PC3 cells by ELISA2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592353Selectivity ratio of IC50 for AKT1 to IC50 for aurora B2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592189Antiproliferative activity against human HEL 92.1.7 cells2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592266Inhibition of human DRAK1 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592270Inhibition of human PKCtheta assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592354Selectivity ratio of IC50 for AKT1 to IC50 for EGFR2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592188Antiproliferative activity against human OCI-AML3 cells2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592179Inhibition of aurora A2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592280Inhibition of AKT12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592191Inhibition of human SGK2 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592263Inhibition of rat ROCK2 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592281Inhibition of ASK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592282Inhibition of EGFR2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592194Inhibition of human RSK4 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592349Selectivity ratio of IC50 for AKT1 to IC50 for PDK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592292Inhibition of PDK1-mediated RSK phosphorylation at Ser221 residue in human OCI-AML-2 cells xenografted in SCID mouse at 100 mg/kg, ip after 3 hrs by LC/MS/MS analysis2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592193Inhibition of human PrKX assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID1310405Inhibition of PDK1 (unknown origin)2016European journal of medicinal chemistry, Aug-08, Volume: 118Locking PDK1 in DFG-out conformation through 2-oxo-indole containing molecules: Another tools to fight glioblastoma.
AID592273Inhibition of human NLK assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592192Inhibition of human PDK1 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592264Inhibition of human ZIPK assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592283Inhibition of GSK3B2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592357Selectivity ratio of IC50 for AKT1 to IC50 for PI3Kgamma2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592186Antiproliferative activity against human K562 cells2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592269Inhibition of human CHK2 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592268Inhibition of human RSK2 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592272Inhibition of rat RSK1 assessed as residual activity at 10 uM2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592359Selectivity ratio of IC50 for AKT1 to IC50 for SYK2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592284Inhibition of IKK12011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID592288AUC in SCID mouse xenografted with human OCI-AML-2 cells at 100 mg/kg, ip administered as a single dose by LC/MS/MS analysis2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID1345388Human 3-phosphoinositide dependent protein kinase 1 (PDK1 family)2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID1345668Human aurora kinase A (Aurora kinase (Aur) family)2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
AID1345688Human aurora kinase B (Aurora kinase (Aur) family)2011Journal of medicinal chemistry, Mar-24, Volume: 54, Issue:6
Structure-based design of potent and selective 3-phosphoinositide-dependent kinase-1 (PDK1) inhibitors.
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023]

Research

Studies (27)

TimeframeStudies, This Drug (%)All Drugs %
pre-19900 (0.00)18.7374
1990's0 (0.00)18.2507
2000's0 (0.00)29.6817
2010's22 (81.48)24.3611
2020's5 (18.52)2.80
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Market Indicators

Research Demand Index: 16.40

According to the monthly volume, diversity, and competition of internet searches for this compound, as well the volume and growth of publications, there is estimated to be moderate demand-to-supply ratio for research on this compound.

MetricThis Compound (vs All)
Research Demand Index16.40 (24.57)
Research Supply Index3.33 (2.92)
Research Growth Index4.55 (4.65)
Search Engine Demand Index10.37 (26.88)
Search Engine Supply Index2.00 (0.95)

This Compound (16.40)

All Compounds (24.57)

Study Types

Publication TypeThis drug (%)All Drugs (%)
Trials0 (0.00%)5.53%
Reviews1 (3.70%)6.00%
Case Studies0 (0.00%)4.05%
Observational0 (0.00%)0.25%
Other26 (96.30%)84.16%
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]