Page last updated: 2024-11-12

forapin

Description

Forapin: used as ointment for treatment of myositis & arthritis; contains bee venom, salicylate, nicotinate & vanillylnonamide [Medical Subject Headings (MeSH), National Library of Medicine, extracted Dec-2023]

Cross-References

ID SourceID
PubMed CID16133648
CHEMBL ID412927
CHEBI ID6736
MeSH IDM0109556

Synonyms (29)

Synonym
gigavlkvlttglpaliswikrkrqq-nh2
forapin
bee venom melittin
melittin (apis cerana)
melittin (major)
forapine
honeybee melittin
g-i-g-a-v-l-k-v-l-t-t-g-l-p-a-l-i-s-w-i-k-r-k-r-q-q-nh2
melittin from honey bee venom, >=85% (hplc)
melittin, >=97% (hplc), synthetic
NCGC00167171-01
CHEMBL412927
chebi:6736 ,
24vt8nve75 ,
unii-24vt8nve75
RS-2008
melittin (gigavlkvlttglpaliswikrkrqq-amide)
VDXZNPDIRNWWCW-JFTDCZMZSA-N
gly-ile-gly-ala-val-leu-lys-val-leu-thr-thr-gly-leu-pro-ala-leu-ile-ser-trp-ile-lys-arg-lys-arg-gln-gln-nh2
gly-l-ile-gly-l-ala-l-val-l-leu-l-lys-l-val-l-leu-l-thr-l-thr-gly-l-leu-l-pro-l-ala-l-leu-l-ile-l-ser-l-trp-l-ile-l-lys-l-arg-l-lys-l-arg-l-gln-l-gln-nh2
glycyl-l-isoleucylglycyl-l-alanyl-l-valyl-l-leucyl-l-lysyl-l-valyl-l-leucyl-l-threonyl-l-threonylglycyl-l-leucyl-l-prolyl-l-alanyl-l-leucyl-l-isoleucyl-l-seryl-l-tryptophyl-l-isoleucyl-l-lysyl-l-arginyl-l-lysyl-l-arginyl-l-glutaminyl-l-glutamamide
AC-32561
AKOS024456456
mfcd00076868
melittin from honey bee venom, >=65% (hplc)
EX-A7430
XM176021
melittin tfa
DTXSID001046261

Research Excerpts

Bioavailability

ExcerptReferenceRelevance
" Two modified melittin peptides displayed rapid bactericidal properties against antibiotic-resistant strains, low innate resistance development by pathogenic bacteria, remained nonimmunogenic for T lymphocytes, and increased bioavailability in tear fluids."( Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
Agrawal, R; Barathi, VA; Beuerman, RW; Chan, LW; Jie, TY; Koh, SK; Lakshminarayanan, R; Leng, ET; Mayandi, V; Sebastian, TM; Somaraju Chalasani, ML; Ting, DSJ; Urf Turabe Fazil, MH; Varadarajan, J; Verma, NK; Xi, Q; Zhou, L, 2020
)
0.56
[information is derived through text-mining from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Roles (7)

RoleDescription
animal metaboliteAny eukaryotic metabolite produced during a metabolic reaction in animals that include diverse creatures from sponges, insects to mammals.
venomA toxin used by animals and injected into their victims by a bite or sting.
EC 2.7.11.13 (protein kinase C) inhibitorAn EC 2.7.11.* (protein-serine/threonine kinase) inhibitor that interferes with the action of protein kinase C (EC 2.7.11.13).
hepatoprotective agentAny compound that is able to prevent damage to the liver.
apoptosis inducerAny substance that induces the process of apoptosis (programmed cell death) in multi-celled organisms.
neuroprotective agentAny compound that can be used for the treatment of neurodegenerative disorders.
antineoplastic agentA substance that inhibits or prevents the proliferation of neoplasms.
[role information is derived from Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Drug Classes (2)

ClassDescription
polypeptideA peptide containing ten or more amino acid residues.
peptidyl amideA peptide that has a carbamoyl group at the C-terminus.
[compound class information is derived from Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Pathways (1)

PathwayProteinsCompounds
Spinal cord injury08

Protein Targets (3)

Potency Measurements

ProteinTaxonomyMeasurementAverage (µ)Min (ref.)Avg (ref.)Max (ref.)Bioassay(s)
phosphopantetheinyl transferaseBacillus subtilisPotency35.48130.141337.9142100.0000AID1490
heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)Homo sapiens (human)Potency15.84890.016525.307841.3999AID602332
nuclear receptor ROR-gamma isoform 1Mus musculus (house mouse)Potency3.91510.00798.23321,122.0200AID2546; AID2551
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Bioassays (849)

Assay IDTitleYearJournalArticle
AID1691361Antimicrobial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1605841Induction of pore formation in negatively charged DOPE/DOPG large unilamellar vesicles assessed as ratio of peptide to lipid molar ratio that induces 50% calcein leakage measured for 60 mins by calcein dequenching based fluorescence based assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1524038Antimicrobial activity against Pseudomonas aeruginosa PAO1 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707845Antimicrobial activity against Staphylococcus aureus ATCC 29213 after 18 hrs by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553820Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of NaCl2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516027Antibacterial activity against Acinetobacter baumannii AB1902 clinical isolate incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524073Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 50% serum albumin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1916054Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1524061Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524087Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.125 mg/ml chymotrypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1691359Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1735128Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella choleraesuis ATCC 133122016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369437Bactericidal activity against Salmonella typhimurium ATCC 140282018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704831Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as reduction of body weight at 0.5 to 5 mg/kg, sc qd for 18 days2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1707931Induction of membrane disruption in Staphylococcus aureus ATCC 25923 assessed as PI-positive cells at 2 times MIC measured after 2 hrs by propidium iodide staining based flow cytometry relative to control2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID704830Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as lethargy at 0.5 to 5 mg/kg, sc qd for 18 days2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1553789Bactericidal activity against Escherichia coli K88 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1433381Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3090 after 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1442105Drug uptake in Pseudomonas aeruginosa ATCC 27853 treated with FITC-labeled compound at MIC after 30 mins by confocal fluorescence microscopy2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1524036Antimicrobial activity against Escherichia coli K99 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1661687Antimicrobial activity against Pseudomonas aeruginosa ATCC 9027 assessed as inhibition of microbial growth incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1553906Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Candida parapsilosis cgmcc2.39892019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707926Binding affinity to LTA (unknown origin) assessed as bacterial killing at 2 times MIC preincubated for 1 hr followed by Staphylococcus aureus ATCC 25923 addition and measured after 2 hrs by colony counting method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1732432Haemolytic activity against human whole blood after 70 mins by monochromator plate reader2021Bioorganic & medicinal chemistry letters, 05-01, Volume: 39Design, synthesis and bioactivity evaluation of novel pyrazole linked phenylthiazole derivatives in context of antibacterial activity.
AID1674632Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 4.5 mM K+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735137Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Micrococcus luteus CMCC 280012016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674682Stability of compound assessed as pepsin (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369497Induction of cell wall permeabilization in Escherichia coli ATCC 25922 assessed as increase in NPN uptake at 1 to 32 uM by fluorescence spectrophotometric method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID762050Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition at 50 ug/ml preincubated with trypsin for 1 hr followed by 18 to 20 hrs incubation in bacterial culture by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID1433413Antimicrobial activity against Staphylococcus aureus KCTC 1621 using 4 hrs trypsin incubated compound measured after overnight incubation by radial diffusion assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1415105Hemolytic activity in sheep RBC assessed as free hemoglobin level at 16 uM by ELISA relative to control2018Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24
Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1765589Antibacterial activity against fungi incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1741129Antibacterial activity against Gram negative bacteria assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1507613Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as cell membrane disruption at 2 times MIC within 4 mins by Sytox Green dye based fluorescence spectrophotometer assay2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1524042Antimicrobial activity against Pseudomonas aeruginosa 25349 clinical isolates after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1063815Toxicity in human RBC assessed as hemolysis by measuring hemoglobin release at 1 uM after 1 hr2014Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2
Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1691345Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1369473Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of MgCl2 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707862Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of FeCl3 by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1905242Disruption of bacterial cell membrane in Escherichia coli ATCC 25922 assessed as proportion of bacteria with intact cell membrane at 5X MIC incubated for 1 hr by PI staining based flow cytometric analysis (Rvb = 99.3%)2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Spermine-Conjugated Short Proline-Rich Lipopeptides as Broad-Spectrum Intracellular Targeting Antibacterial Agents.
AID704824Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as lethargy at 0.5 to 5 mg/kg, sc qd for 7 days2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674617Hemolytic activity in human RBC assessed as hemolysis at 1 to 128 uM relative to control2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369459Fungicidal activity against Candida albicans SP3902 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1415107Cytotoxicity against mouse RAW264.7 cells at 32 uM after 48 hrs by MTT assay relative to control2018Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24
Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1707856Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of NaCl by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369442Bactericidal activity against Staphylococcus aureus ATCC 259232018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704817Antiangiogenic activity against VEGFA-stimulated cell proliferation in HUVEC after 48 hrs by BrdU incorporation assay2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1140123Toxicity in erythrocytes (unknown origin) assessed as hemolytic activity2014Journal of natural products, Apr-25, Volume: 77, Issue:4
Antimicrobial peptides from skin secretions of Hypsiboas pulchellus (Anura: Hylidae).
AID1469697Cytotoxicity against human peripheral blood leukocytes assessed as cell viability at 0.18 uM after 24 hrs by acridine orange/ethidium bromide staining based fluorescence microscopic method relative to control2018Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7
Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID704829Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as hair loss at 0.5 to 5 mg/kg, sc qd for 18 days2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369479Antifungal activity against Candida albicans cgmcc 2.2086 in presence of NH4Cl by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553828Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of KCl by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553902Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Staphylococcus epidermidis ATCC 122282019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707855Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for methicillin-resistant Staphylococcus aureus 1132021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1827088Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1674593Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 259222020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369504Binding affinity to phosphatidylglycerol/cardiolipin/phosphatidylethanolamine large unilamellar vesicle assessed as induction of calcein leakage at 2 to 32 uM after 15 mins by spectrofluorophotometric method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID357110Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1524128Bactericidal activity against Pseudomonas aeruginosa CICC 21630 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674628Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 25% human serum by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553813Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of NaCl2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524144Stability of the compound assessed as trypsin (unknown origin)-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID656069Induction of membrane damage in Aspergillus fumigatus at 1.56 to 100 uM at pH 5.5 by Sytox green-based fluorescence assay2012Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3
Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1707929Induction of membrane disruption in Staphylococcus aureus ATCC 25923 measured after 2 hrs by propidium iodide staining based confocal laser scanning microscopic analysis2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1423347Cytotoxicity against HUVEC after 24 hrs by MTT assay2018Journal of natural products, 11-26, Volume: 81, Issue:11
Discovery and Characterization of Cyclotides from Rinorea Species.
AID704826Antiangiogenic activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of vessel formation at 5 mg/kg, sc qd for 7 days relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1741174Induction of cell membrane permeability in Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by SYTOX dye based fluorescence assay2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1063817Antibacterial activity against Staphylococcus aureus by broth microdilution method2014Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2
Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1442085Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1516086Resistance index, ratio of MIC for antibacterial activity against ciprofloxacin-resistant Escherichia coli to MIC for Escherichia coli ATCC 25922 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369458Fungicidal activity against Candida albicans SP3903 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765580Antibacterial activity against Acinetobacter baumannii ATCC 19606 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1516074Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of CaCl2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID704832Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of tumor weight at 5 mg/kg, sc qd for 18 days relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369436Bactericidal activity against Escherichia coli 10052018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID163107Minimum inhibitory concentration against Pseudomonas aeruginosa ATCC 90272004Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5
Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1827093Antibacterial activity against Salmonella typhimurium ATCC 14028 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1735131Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Vibrio parahaemolyticus CICC 216172016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1691357Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Staphylococcus aureus KCTC 16212020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1827089Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1691360Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1553895Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Salmonella pullorum ATCC 79132019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735111Antibacterial activity against Staphylococcus aureus GIM 1.160 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1735138Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Bacillus pumilus CMCC 632022016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1516056Antibacterial activity against Escherichia coli ATCC 25922 in presence of ZnCl2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1809834Disruption of membrane integrity in human RBC cells assessed as membrane damage at 150 uM incubated for 15 min by Alexa fluor-annexin V staining based assay (Rvb = 0%)2021Journal of medicinal chemistry, 10-28, Volume: 64, Issue:20
Tandem Repeat of a Short Human Chemerin-Derived Peptide and Its Nontoxic d-Lysine-Containing Enantiomer Display Broad-Spectrum Antimicrobial and Antitubercular Activities.
AID1516041Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553896Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Pseudomonas aeruginosa ATCC 278532019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1741119Antibacterial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1605795Antibacterial activity against methicillin-sensitive Staphylococcus aureus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1369454Antifungal activity against Candida krusei cgmcc 2.1857 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID656064Stability of the compound at 1 ug/uL after 2 hrs by RP-HPLC analysis in presence of proteinase K2012Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3
Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1553893Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli UB10052019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369434Antibacterial activity against Staphylococcus aureus ATCC 25923 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553814Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of KCl2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID425067Antibacterial activity against Listeria monocytogenes ATCC 19111 in assay tube containing mixture of erythrocyte/Listeria monocytogenes cells assessed as logarithmic reduction in CFU after 30 mins2007Antimicrobial agents and chemotherapy, Nov, Volume: 51, Issue:11
Antimicrobial effect of halocidin-derived peptide in a mouse model of Listeria infection.
AID1916059Antibacterial activity against Pseudomonas aeruginosa ATCC 9027 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID770122Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID357108Antibacterial activity against Pseudomonas aeruginosa CUN 4158-02 after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1609338Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605807Antibacterial activity against Acinetobacter baumannii 1001 assessed as reduction in bacterial viability at 2 or 4 times MIC incubated up to 24 hrs in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time kill kinetics assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1741109Cytotoxicity against mouse RAW264.7 cells assessed as reduction in cell viability at 20 uM incubated for 24 hrs by MTT assay2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1765609Antibacterial activity against Klebsiella pneumoniae ATCC 700603 incubated with 0.02 ug/ml trypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553833Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of NH4Cl by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524066Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of NaCl2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707859Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of MgCl2 by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516053Antibacterial activity against Escherichia coli ATCC 25922 in presence of KCl by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674635Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 6 uM NH4+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735127Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Shigella flexneri CMCC 515712016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1553798Fungicidal activity against Candida parapsilosis cgmcc2.3989 incubated for 48 hrs followed by replating on YM agar plate and measured after 48 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674681Stability of compound assessed as chymotrypsin (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1516055Antibacterial activity against Escherichia coli ATCC 25922 in presence of MgCl2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369464Fungicidal activity against Candida albicans 14936 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1129352Cytotoxicity against human HeLa cells after 1 hr by MTS/PMS assay2014Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7
Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1553782Antifungal activity against Candida parapsilosis cgmcc2.3989 measured after 48 hrs by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735105Antibacterial activity against Shigella flexneri CMCC 51571 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1661689Hemolytic activity in human RBC assessed as induction of hemolysis incubated for 1 hr2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1707864Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of 5% serum by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID357112Antibacterial activity against Escherichia coli K12 ATCC 23716 after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1827085Antibacterial activity against Salmonella enterica subsp. enterica serovar Typhimurium C77-31 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1605789Antibacterial activity against Staphylococcus aureus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1735113Antibacterial activity against Listeria monocytogenes CICC 21633 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1741111Cytotoxicity against mouse RAW264.7 cells assessed as reduction in cell viability at 1.25 to 80 uM incubated for 24 hrs by MTT assay2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1735134Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Listeria monocytogenes CICC 216622016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1707850Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Staphylococcus epidermidis ATCC 122282021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1765610Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated with 0.02 ug/ml chymotrypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553824Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of ZnCl22019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1442119Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of ZnCl2 by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID654511Induction of apoptosis in human activated PBMC assessed as internucleosomal DNA fragmentation at 1.6 uM by annexinV/propidium iodide staining-based flow cytometric analysis2012Journal of natural products, Feb-24, Volume: 75, Issue:2
Do plant cyclotides have potential as immunosuppressant peptides?
AID1707851Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 259232021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369503Binding affinity to phosphatidylcholine/cholesterol large unilamellar vesicle assessed as induction of calcein leakage at 2 to 32 uM after 15 mins by spectrofluorophotometric method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369465Fungicidal activity against fluconazole-resistant Candida albicans 17546 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674583Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus epidermidis ATCC 122282020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID704834Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of tumor weight at 0.5 mg/kg, sc qd for 18 days relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674690Stability of compound assessed as pepsin (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1605790Antifungal activity against Candida albicans assessed as reduction in fungal growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1735115Antibacterial activity against Micrococcus luteus CMCC 28001 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369470Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of NaCl by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1423352Hemolytic activity against human RBC after 1 hr2018Journal of natural products, 11-26, Volume: 81, Issue:11
Discovery and Characterization of Cyclotides from Rinorea Species.
AID1661684Antimicrobial activity against Staphylococcus aureus ATCC 6538 assessed as inhibition of microbial growth incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1765575Antibacterial activity against Enterococcus faecalis ATCC 29212 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1442086Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID704816Antiangiogenic activity against VEGFA-stimulated capillary differentiation in HUVEC after 18 hrs by matrigel assay2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1605824Stability of the compound in rabbit tear fluid measured after 2 hrs by UPLC-MS analysis2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1674646Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL chymotrypsin for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1609357Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1827083Antibacterial activity against Staphylococcus epidermidis ATCC 12228 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1674642Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of chymotrypsin by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524131Bactericidal activity against Pseudomonas aeruginosa 25349 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1827092Antibacterial activity against Salmonella enterica subsp. enterica serovar Typhimurium C77-31 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1516085Antibacterial activity against ciprofloxacin-resistant Escherichia coli ATCC 25922 incubated for 18 to 24 hrs2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741118Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1413644Induction of membrane disruption in methicillin-resistant Staphylococcus aureus JCSC 4788 assessed as increase in fluorescence intensity at 0.25 to 8 ug/ml measured after 3 hrs by SYTOX green dye based fluorescence assay2018MedChemComm, Oct-01, Volume: 9, Issue:10
Structural optimization and antibacterial evaluation of rhodomyrtosone B analogues against MRSA strains.
AID1469657Bactericidal activity against Escherichia coli ATCC 25922 after 18 hrs by microdilution method2018Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7
Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1369474Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of CaCl2 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1516087Displacement of BODIPY-TR-cadaverine from Escherichia coli O111:B4 LPS by spectrofluorophotometric method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1569925Antibacterial activity against Escherichia coli MG1655 assessed as reduction in bacterial cell growth incubated for 24 hrs by microtiter dilution method2019European journal of medicinal chemistry, Oct-15, Volume: 180Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID1516083Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of NaBH4 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID770124Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1674636Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 6 uM Fe3+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735132Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 292132016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1741113Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID357113Antibacterial activity against Escherichia coli K12 ATCC 23716 in 10% Luria-Bertani medium/90% Hepes buffer at pH 7.02007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1442093Antibacterial activity against Pseudomonas aeruginosa 21328 clinical isolate after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1369431Antibacterial activity against Staphylococcus aureus ATCC 29213 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1701043Induction of inner membrane permeability in Escherichia coli assessed as cytoplasmic beta-galactosidase release at 5 uM using ONPG2020Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23
Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1369463Fungicidal activity against fluconazole-resistant Candida albicans 56214 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369433Antibacterial activity against Staphylococcus epidermidis ATCC 12228 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1735129Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella typhimurium CMCC 510052016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674610Antibacterial activity against Salmonella choleraesuis 503 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369446Antifungal activity against Candida albicans SP3902 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553795Bactericidal activity against Staphylococcus aureus ATCC 25923 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1609430Induction of cytoplasmic membrane depolarization in Staphylococcus aureus at 2 times of MIC within 4 mins by SYTOX green-based assay2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605805Antibacterial activity against vancomycin-resistant Enterococcus faecalis 1010 assessed as log10 reduction in bacterial viability at 2 to 4 times MIC incubated for 30 mins in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time ki2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1516025Antibacterial activity against Escherichia coli 20411 clinical isolate incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1827090Antibacterial activity against Staphylococcus epidermidis ATCC 12228 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1553774Antibacterial activity against Escherichia coli K99 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1507590Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3090 after 24 hrs2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1827102Cytotoxicity against mouse RAW264.7 cells assessed as inhibition of cell growth at pH 7.4 measured after 24 hrs by MTT assay2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1701048Induction of cell killing in Escherichia coli assessed as time needed for bacterial destruction at 128 ug/ml2020Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23
Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1553797Fungicidal activity against Candida albicans cgmcc2.2086 incubated for 48 hrs followed by replating on YM agar plate and measured after 48 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369427Antibacterial activity against Escherichia coli ATCC 25922 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704822Cytotoxicity against HUVEC assessed as cell viability at 1 uM after 48 hrs by MTT assay relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID577465Toxicity in RBC assessed as hemolysis2010Antimicrobial agents and chemotherapy, Oct, Volume: 54, Issue:10
Cationic amphiphiles, a new generation of antimicrobials inspired by the natural antimicrobial peptide scaffold.
AID1369471Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of KCl by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707941Induction of reactive oxygen species generation in Staphylococcus aureus ATCC 25923 by DCFH-DH dye based fluorescence assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553777Antibacterial activity against Staphylococcus epidermidis ATCC 12228 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674603Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1442096Cytotoxicity in mouse RAW264.7 cells after 24 hrs by MTT assay2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1516076Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of 12.5% serum by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID710199Antibacterial activity against Bacillus megaterium ATCC 10778 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1674625Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 8 uM Zn2+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369438Bactericidal activity against Salmonella pullorum ATCC 79132018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704815Down regulation of VEGFR2 expression in VEGFA-stimulated HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674631Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 150 mM Na+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1707865Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of 10% serum by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553905Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Candida albicans cgmcc2.20862019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553807Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 at sub-MBC measured after 17 serial passages2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674624Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 1 mM Mg2+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1740177Hemolytic activity in human RBC preincubated for 10 mins under shaking condition and measured after 1 hr2020European journal of medicinal chemistry, Sep-01, Volume: 201Synthesis, antibacterial and antifungal activity of new 3-biphenyl-3H-Imidazo[1,2-a]azepin-1-ium bromides.
AID1616109Inhibition of F1F0-ATP synthase in Escherichia coli2019European journal of medicinal chemistry, Nov-15, Volume: 182Recent advancements in mechanistic studies and structure activity relationship of F
AID1524129Bactericidal activity against Pseudomonas aeruginosa 26305 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369498Induction of cell wall permeabilization in Candida albicans cgmcc 2.2086 assessed as increase in NPN uptake at 1 to 32 uM by fluorescence spectrophotometric method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1539038Disruption of membrane integrity in methicillin-reisitant Staphylococcus aureus JCSC 4744 at 10 ug/ml measured within 2 mins by SYTOX-greeen-based fluorescence assay2019Journal of natural products, 07-26, Volume: 82, Issue:7
Callistemonols A and B, Potent Antimicrobial Acylphloroglucinol Derivatives with Unusual Carbon Skeletons from
AID1516077Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of 25% serum by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553827Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of NaCl by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1765620Antibiofilm activity against Klebsiella pneumoniae ATCC 700603 at 2 to 4 times MIC incubated for 24 hrs by crystal violet staining based assay2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553767Antibacterial activity against Escherichia coli ATCC 25922 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707873Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at 0.5 times MIC preincubated for 4 hrs followed by replating on MHB agar and measured after 24 hrs by time kill assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524075Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 12.5% serum albumin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674588Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella pullorum 79132020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553804Bactericidal activity against Staphylococcus aureus ATCC 29213 assessed as reduction in bacterial growth at MBC by time-kill assay2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524065Selectivity ratio of IC50 for pig IPECJ2 cells to geometric mean of the peptide MBC for bacteria2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID704813Down regulation of COX2 expression in VEGFA-stimulated HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1516024Antibacterial activity against Staphylococcus epidermidis ATCC 12228 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1905562Antimicrobial activity against Bacillus subtilis ATCC 23857 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1524114Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 at 2 uM up to 5000 secs by DiSC3-5 dye-based fluorescence spectrophotometric method2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765581Hemolytic activity in BALB/C mouse erythrocytes incubated for 1 hr by absorbance method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553821Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of KCl2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524054Hemolytic activity against human RBC after 1 hr2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1337937Disruption of cytoplasmic membrane potential in methicillin-resistant Staphylococcus aureus JCSC 2172 at 10 ug/ml after 4 hrs by SYTOX green dye based fluorescence assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Structure-activity relationships and optimization of acyclic acylphloroglucinol analogues as novel antimicrobial agents.
AID704808Inhibition of VEGFA-stimulated VEGF production in HUVEC at 5 to 20 uM after 24 hrs by enzyme immunoassay2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674647Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL pepsin for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674623Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 4.5 mM K+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1691353Hemolytic activity in sheep RBC measured after 2 hrs by ELISA2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1442116Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of NaCl by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1905213Disruption of bacterial cell membrane in Escherichia coli ATCC 25922 at 5XMIC by SEM analysis2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Spermine-Conjugated Short Proline-Rich Lipopeptides as Broad-Spectrum Intracellular Targeting Antibacterial Agents.
AID1605796Antibacterial activity against methicillin-resistance Staphylococcus aureus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1741130Antifungal activity against yeast assessed as reduction in fungal growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID704802Down regulation of VEGFA-stimulated VEGF-A expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis in presence of p38 inhibitor SB2035802012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1433396Induction of inner membrane permeabilisation in Escherichia coli ML-35 assessed as ONPG hydrolysis up to 30 ug/ml by beta-galactosidase enzyme coupled spectrophotometric analysis2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1516020Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID710194Antibacterial activity against Staphylococcus aureus ATCC 25923 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID357109Antibacterial activity against cationic peptide-resistant Yersinia pestis KIM pYV- after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID710125Antibacterial activity against Aeromonas caviae ATCC 15648 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1553826Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of NH4Cl2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID710198Antibacterial activity against Enterococcus faecalis CIP 186 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1524033Antimicrobial activity against Escherichia coli UB1005 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1869113Antimicrobial activity against Pseudomonas aeruginosa KCTC 1637 assessed as minimal inhibitory concentration incubated for 18 hrs2022Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11
Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1553894Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Salmonella typhimurium ATCC 140282019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605806Antibacterial activity against vancomycin-resistant Enterococcus faecalis 1002 assessed as log10 reduction in bacterial viability at 2 to 4 times MIC incubated for 30 mins in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time ki2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1524147Stability of the compound assessed as Tritirachium album proteinase K-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1129357Cytotoxicity against HUVEC after 1 hr by MTS/PMS assay2014Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7
Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1524037Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674691Stability of compound assessed as proteinase K (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369447Antifungal activity against Candida albicans SP3876 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524044Antimicrobial activity against Salmonella typhimurium C7731 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605811Induction of pore formation in intact vancomycin-resistant Enterococcus faecalis 1002 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1765579Antibacterial activity against Klebsiella pneumoniae ATCC 700603 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1674639Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 100% human serum by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369505Binding affinity to phosphatidylcholine/phosphatidylethanolamine/phosphatidylinositol/ergosterol large unilamellar vesicle assessed as induction of calcein leakage at 2 to 32 uM after 15 mins by spectrofluorophotometric method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674629Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 50% human serum by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID357106Antibacterial activity against Bordetella bronchiseptica CUN 11844-99 after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1369450Antifungal activity against fluconazole-resistant Candida albicans 56214 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674622Cytotoxicity against HEK-293T cells assessed as reduction in cell viability at lower concentration by MTT assay2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524085Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.5 mg/ml chymotrypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1516067Antibacterial activity against Escherichia coli ATCC 25922 in presence of NaBH4 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID704821Cytotoxicity against HUVEC assessed as cell viability at 5 uM after 48 hrs by MTT assay relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1433385Antibacterial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 after 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1369461Fungicidal activity against Candida albicans isolated from alveolar fluid after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707849Hemolytic activity against mouse erythrocytes measured after 1 hr2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516026Antibacterial activity against Acinetobacter baumannii AB1901 clinical isolate incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674612Antibacterial activity against Enterococcus faecalis ATCC 29212 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1609355Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1516075Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of FeCl3 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707914Antibiofilm activity against ciprofloxacin-resistant Staphylococcus aureus ATCC 25923 at 0.5 to 8 uM after 24 hrs by crystal violet staining based assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1735121Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Escherichia coli O157:H7 CICC 215302016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674648Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL proteinase K for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1661688Antimicrobial activity against Candida albicans ATCC 10231 assessed as inhibition of microbial growth incubated for 48 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1741175Induction of cell membrane permeability in Escherichia coli KCTC 1682 assessed as cytoplasmic membrane depolarization at 2 times MIC by ONPG dye based spectrophotometry2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516036Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus epidermidis ATCC 122282019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1719771Hemolytic activity in human RBC assessed as hemolysis incubated for 1 hr by CO-ADD method
AID770111Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition at 50 ug/ml after 18 to 20 hrs by broth microdilution method in presence of trypsin2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID69475Minimum inhibitory concentration against Escherichia coli ATCC 259222004Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5
Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1516021Antibacterial activity against Salmonella enterica serovar typhimurium C77-31 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1605788Antibacterial activity against Pseudomonas aeruginosa assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1553769Antibacterial activity against Salmonella typhimurium ATCC 14028 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605797Antibacterial activity against vancomycin-resistant Enterococcus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1553817Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of ZnCl22019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1129355Cytotoxicity against rat IEC-6 cells after 1 hr by MTS/PMS assay2014Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7
Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID583614Toxicity in human RBC assessed as hemolysis upto 25 ug/ml2010Antimicrobial agents and chemotherapy, Sep, Volume: 54, Issue:9
New antiseptic peptides to protect against endotoxin-mediated shock.
AID1827113Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 7.4 in presence of 50% serum2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID710127Antibacterial activity against Klebsiella oxytoca CIP 7932 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1741110Cytotoxicity against mouse NIH/3T3 cells assessed as reduction in cell viability at 20 uM incubated for 24 hrs by MTT assay2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1707876Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at 2 times MIC preincubated for 2 hrs followed by replating on MHB agar and measured after 24 hrs by time kill assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1469691Induction of membrane permeabilization in Escherichia coli ATCC 25922 assessed as loss of pili/flagella at MIC after 1 hr by atomic force microscopic method2018Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7
Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1741179Induction of cell membrane permeability in Escherichia coli KCTC 1682 assessed as cytoplasmic membrane depolarization by measuring PI fluorescent signals at 2 times MIC measured after 1 hr by propidium iodide dye based flow cytometry analysis (Rvb = 9.8 %2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1735106Antibacterial activity against Salmonella choleraesuis ATCC 13312 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID447945Toxicity in human erythrocytes assessed as hemolytic activity at 5 ug/ml at pH 7.4 after 1 hr2009Bioorganic & medicinal chemistry letters, Oct-01, Volume: 19, Issue:19
Synthesis of antibacterial pseudopeptides with less hemolytic activity from a cytotoxic peptide and their pH-dependent activity.
AID1707881Antimicrobial activity against Staphylococcus aureus ATCC 25923 at 0.5 times MIC after 15 passages by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524086Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.25 mg/ml chymotrypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1423350Cytotoxicity against human MDA-MB-231 after 24 hrs by MTT assay2018Journal of natural products, 11-26, Volume: 81, Issue:11
Discovery and Characterization of Cyclotides from Rinorea Species.
AID1524132Bactericidal activity against Salmonella typhimurium ATCC 14028 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1905563Antimicrobial activity against Staphylococcus epidermidis ATCC 12228 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1701045Induction of inner membrane permeability in Escherichia coli at 5 uM incubated for 1 hr by SYTOX Green-staining based flow cytometry analysis2020Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23
Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1553776Antibacterial activity against Salmonella typhimurium C7731 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605798Antibacterial activity against multidrug-resistant Acinetobacter baumannii assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID770113Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1735114Antibacterial activity against Bacillus cereus CMCC 63301 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID770123Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1674688Stability of compound assessed as trypsin (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553831Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of ZnCl by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369466Fungicidal activity against Candida tropicalis cgmcc 2.1975 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524146Stability of the compound assessed as pepsin (unknown origin)-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID710126Antibacterial activity against Enterobacter aerogenes ATCC 13048 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1674607Antibacterial activity against Salmonella typhimurium 14028 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1827098Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1609431Induction of membrane integrity disruption in Escherichia coli at 2 times of MIC by propidium iodide staining based flow cytometry relative to control (Rvb = 2.97 %)2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1735103Antibacterial activity against Salmonella paratyphi B CICC 21495 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369478Antifungal activity against Candida albicans cgmcc 2.2086 in presence of KCl by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1916055Antibacterial activity against methicillin-resistant Staphylococcus aureus N315 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID704806Inhibition of VEGFA-stimulated JNK phosphorylation in HUVEC by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1616110Inhibition of F1F0-ATP synthase in Escherichia coli relative to control2019European journal of medicinal chemistry, Nov-15, Volume: 182Recent advancements in mechanistic studies and structure activity relationship of F
AID1090767Fungicidal activity against Penicillium digitatum PHI-26 conidia assessed as inhibition of conidia viability incubated for 16 hr by colony count assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1605842Binding affinity to zwitterionic DOPC/cholesterol large unilamellar vesicles assessed as transformation of peptide secondary structure to alpha-helical conformation by CD spectropolarimetry2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1129353Cytotoxicity against human Caco2 cells after 1 hr by MTS/PMS assay2014Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7
Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1905567Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1707852Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 292132021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1661690Microbicidal activity against Bacillus subtilis ATCC 6633 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1765574Antibacterial activity against Bacillus subtilis ATCC 23857 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1507591Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3095 after 24 hrs2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1827086Antibacterial activity against Salmonella typhimurium ATCC 14028 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1433374Therapeutic index, ratio of MHC for sheep RBC to MIC for Pseudomonas aeruginosa KCTC 16372017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1827097Antibacterial activity against Staphylococcus aureus ATCC 25923 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1524034Antimicrobial activity against Escherichia coli 078 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1433383Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 after 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1527499Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method2020European journal of medicinal chemistry, Jan-01, Volume: 185Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1869120Antimicrobial activity against Staphylococcus epidermidis KCTC 1917 assessed as minimal inhibitory concentration incubated for 18 hrs2022Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11
Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1524133Bactericidal activity against Salmonella typhimurium C7731 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553859Induction of membrane disruption in PC/CL large unilamellar vesicles assessed as calcein-entrapped liposome leakage at 1 uM after 15 mins by spectrofluorophotometric assay relative to control2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369452Antifungal activity against fluconazole-resistant Candida albicans 17546 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1741127Hemolytic activity in sheep RBC assessed as reduction in hemoglobin incubated for 1 hr2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1553764Hemolytic activity in human RBC at 128 uM measured after 1 hr relative to control2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1756133Hemolytic activity against human RBC assessed as concentration required to cause 50% hemolysis measured after 1 hr
AID1707882Antimicrobial activity against Staphylococcus epidermidis ATCC 12228 at 0.5 times MIC after 15 passages by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553900Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Salmonella typhimurium C77312019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369485Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of 25% human heat-inactivated serum by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524127Bactericidal activity against Pseudomonas aeruginosa PAO1 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553866Induction of outer membrane permeabilization in Escherichia coli ATCC 25922 at 1 to 64 uM by NPN-dye based assay2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516081Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 12 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553765Cytotoxicity against mouse RAW264.7 cells assessed as cell viability at 2 to 64 uM measured after 18 to 24 hrs by MTT assay relative to control2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553816Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of MgCl22019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1442090Antibacterial activity against ciprofloxacin-resistant Pseudomonas aeruginosa 11411 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1433395Induction of outer membrane permeabilization in Escherichia coli KCTC 1682 assessed as NPN uptake by spectrofluorophotometric analysis2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1516034Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 292132019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674616Hemolytic activity in human RBC assessed as hemolysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735119Antifungal activity against Candida albicans ATCC 10231 assessed as fungal growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1827104Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 6.5 in presence of NaCl2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1661695Microbicidal activity against Candida albicans ATCC 10231 assessed as inhibition of colony growth incubated for 48 hrs followed by replating and further incubated for 48 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1765590Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for bacteria2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1507589Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3089 after 24 hrs2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1691356Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Bacillus subtilis KCTC 30682020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1090763Toxicity in Homo sapiens (human) RBCs assessed as hemolytic activity2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1741131Therapeutic index, ratio of HC10 for sheep RBC to geometric mean MIC for gram positive bacteria2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID704819Cytotoxicity against HUVEC assessed as cell viability at 20 uM after 48 hrs by MTT assay relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1735101Antibacterial activity against Escherichia coli ATCC 35150 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1433373Therapeutic index, ratio of MHC for sheep RBC to MIC for Escherichia coli KCTC 16822017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1609354Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID357111Antibacterial activity against Brucella abortus 9.19 (per-) after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID770120Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1527502Antimicrobial activity against multi drug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method2020European journal of medicinal chemistry, Jan-01, Volume: 185Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1553787Bactericidal activity against Salmonella pullorum ATCC 7913 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1741112Cytotoxicity against mouse NIH/3T3 cells assessed as reduction in cell viability at 1.25 to 80 uM incubated for 24 hrs by MTT assay2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674614Antibacterial activity against Streptococcus agalactiae H92 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID654510Antiproliferative activity against activated human PBMC assessed as decrease in cell division at 1.6 uM after 72 hrs by flow cytometric analysis2012Journal of natural products, Feb-24, Volume: 75, Issue:2
Do plant cyclotides have potential as immunosuppressant peptides?
AID1735152Induction of cell membrane depolarization in Escherichia coli O157:H7 CICC 21530 assessed as increase in fluorescence intensity at 0.5 to 2 times MIC preincubated for 90 mins followed by KCl addition and measured after 15 to 30 mins by DiSC3-5 staining ba2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674689Stability of compound assessed as chymotrypsin (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID704810Down regulation of COX2 expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1553785Bactericidal activity against Escherichia coli UB1005 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674640Stability of compound at 100 degreeC after 30 to 90 mins2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1516030Haemolytic activity in human erythrocytes assessed as lowest concentration causing 5% hemolysis after 1 hr2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369484Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of 12.5% human heat-inactivated serum by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1827101Ratio of MHC for hemolytic activity against human RBC assessed as hemoglobin release at pH 6.5 to MHC for hemolytic activity against human RBC assessed as hemoglobin release at pH 7.42022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1516023Antibacterial activity against Escherichia coli ATCC 25922 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516064Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 10 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524124Bactericidal activity against Escherichia coli K88 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369445Antifungal activity against Candida albicans SP3903 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765578Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1516069Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of NaCl by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524135Bactericidal activity against Acinetobacter baumannii incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID577469Antimicrobial activity against Escherichia coli2010Antimicrobial agents and chemotherapy, Oct, Volume: 54, Issue:10
Cationic amphiphiles, a new generation of antimicrobials inspired by the natural antimicrobial peptide scaffold.
AID1553803Bactericidal activity against Escherichia coli ATCC 25922 assessed as reduction in bacterial growth at MBC by time-kill assay2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553897Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli K882019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1741122Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674637Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 25% human serum by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735122Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 259222016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524040Antimicrobial activity against Pseudomonas aeruginosa 26305 clinical isolates after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553904Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Staphylococcus aureus ATCC 292132019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707846Antimicrobial activity against Bacillus subtilis ATCC 23857 after 18 hrs by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369457Fungicidal activity against Candida albicans SP3931 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524079Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.5 mg/ml trypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1827111Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 7.4 in presence of NaCl2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1674609Antibacterial activity against Salmonella pullorum 7913 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735118Antibacterial activity against methicillin resistant Staphylococcus aureus ATCC 43300 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1507592Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 after 24 hrs2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID704811Down regulation of VEGF-A expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1735135Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Listeria monocytogenes CICC 216332016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1337921Antibacterial activity against methicillin-resistant Staphylococcus aureus JCSC 2172 after 8 to 12 hrs by resazurin dye based microdilution method2017European journal of medicinal chemistry, Jan-05, Volume: 125Structure-activity relationships and optimization of acyclic acylphloroglucinol analogues as novel antimicrobial agents.
AID1524111Induction of outer membrane permeabilization in Escherichia coli ATCC 25922 at 1 uM by NPN-dye based assay relative to control2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1457539Cytotoxicity against mouse J774A.1 cells assessed as damage to cell membrane by measuring propidium iodide intake at 5 uM by spectrofluorometric analysis2017Journal of medicinal chemistry, 07-27, Volume: 60, Issue:14
Lipophosphonoxins II: Design, Synthesis, and Properties of Novel Broad Spectrum Antibacterial Agents.
AID1369432Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 4330 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1605810Induction of pore formation in intact vancomycin-resistant Enterococcus faecalis ATCC 29212 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1369428Antibacterial activity against Escherichia coli 1005 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674589Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella typhimurium 77312020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524041Antimicrobial activity against Pseudomonas aeruginosa CICC 21625 clinical isolates after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605799Antibacterial activity against Carbapenem-Resistant Enterobacteriaceae assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1735136Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Bacillus cereus CMCC 633012016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID357105Antibacterial activity against Acinetobacter baumannii ATCC 19606 after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1765591Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for fungi2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1691362Antimicrobial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1553800Hemolytic activity in human RBC measured after 1 hr2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524130Bactericidal activity against Pseudomonas aeruginosa CICC 21625 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707868Ratio of MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in presence of 2.5% serum to MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in absence of serum2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID704827Antiangiogenic activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of vessel formation at 0.5 mg/kg, sc qd for 7 days relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1516061Antibacterial activity against Escherichia coli ATCC 25922 in presence of 50% serum by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741125Antifungal activity against Candida albicans KCTC 7965 assessed as reduction in fungal growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674587Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus 110112020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553778Antibacterial activity against Staphylococcus aureus ATCC 25923 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1569924Antibacterial activity against Chlamydia trachomatis D/UW-3/Cx infected in mouse McCoy cells assessed as reduction in infected cells preincubated for 2 hrs and measured after 48 hrs by immunofluorescence method2019European journal of medicinal chemistry, Oct-15, Volume: 180Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID704812Down regulation of VEGFR2 expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1524035Antimicrobial activity against Escherichia coli K88 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1735099Antibacterial activity against Escherichia coli O157:H7 CICC 21530 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID704809Inhibition of VEGFA-stimulated PGE2 production in HUVEC at 5 to 20 uM after 24 hrs by ELISA2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1609341Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID770125Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1765616Induction of inner membrane permeabilization in Klebsiella pneumoniae ATCC 700603using ONPG as substrate by spectroscopic method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1442120Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of MgCl2 by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1553898Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli K992019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553822Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of CaCl22019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707913Antibiofilm activity against Staphylococcus aureus ATCC 25923 at 0.5 to 8 uM after 24 hrs by crystal violet staining based assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524069Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of ZnCl22019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1516022Antibacterial activity against Escherichia coli UB1005 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516062Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524080Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.25 mg/ml trypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1827091Antibacterial activity against Staphylococcus aureus ATCC 25923 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1524076Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 4 mg/ml trypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369430Antibacterial activity against Salmonella pullorum ATCC 7913 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765573Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1735102Antibacterial activity against Salmonella paratyphi A CICC 20501 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524077Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 2 mg/ml trypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765592Antibacterial activity against Gram-positive bacteria incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1741124Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1090771Antimicrobial activity against Saccharomyces cerevisiae FY1679 assessed as microbial growth inhibition after 4 days by microtiter plate assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID125770Minimum inhibitory concentration against Micrococcus luteus ATCC 93412004Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5
Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1553796Bactericidal activity against Staphylococcus aureus ATCC 29213 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707861Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of ZnCl2 by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID70092Compound was evaluated for antibacterial activity against Escherichia coli1996Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16
De novo antimicrobial peptides with low mammalian cell toxicity.
AID1916057Antibacterial activity against Escherichia coli ATCC 25922 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1369455Antifungal activity against Candida parapsilosis cgmcc 2.3989 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553808Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 assessed as ratio of MBC after and before 30 serial passages at sub-MBC2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827103Cytotoxicity against mouse RAW264.7 cells assessed as inhibition of cell growth at pH 6.5 measured after 24 hrs by MTT assay2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1735125Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella paratyphi B CICC 214952016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1905561Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1553857Induction of membrane disruption in PG/CL/PE large unilamellar vesicles assessed as calcein-entrapped liposome leakage at 1 to 64 uM after 15 mins by spectrofluorophotometric assay2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1609340Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1661693Microbicidal activity against Escherichia coli ATCC 8739 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1369439Bactericidal activity against Staphylococcus aureus ATCC 292132018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524046Antimicrobial activity against Acinetobacter baumannii after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524055Cytotoxicity against mouse RAW264.7 cells assessed as cell death after 18 to 24 hrs by MTT assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID770121Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1916063Antibacterial activity against Klebsiella pneumoniae ATCC 14581 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1524153Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 assessed as induction cytoplasmic ONPG release at 2 to 16 uM up to 120 mins by DiSC3-5 dye-based fluorescence spectrophotometric method2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1691354Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Escherichia coli KCTC 16822020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1369462Fungicidal activity against fluconazole-resistant Candida albicans 56452 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID710197Antibacterial activity against Streptococcus equinus ATCC 5623 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1412406Induction of membrane disruption in methicillin-sensitive Staphylococcus aureus FDA 209P assessed as increase in K+ efflux at 10 uM after 30 mins relative to control2018MedChemComm, Mar-01, Volume: 9, Issue:3
Membrane-active antimicrobial poly(amino-modified alkyl) β-cyclodextrins synthesized
AID1674683Stability of compound assessed as proteinase K (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1433377Therapeutic index, ratio of MHC for sheep RBC to MIC for Staphylococcus aureus KCTC 16212017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1674626Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 6 uM NH4+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1691355Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Pseudomonas aeruginosa KCTC 16372020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1735120Hemolytic activity against human red blood cells assessed as concentration required to cause 10% hemoglobin release measured after 1 hr by microplate reader analysis2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1707875Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at 4 times MIC preincubated for 30 mins followed by replating on MHB agar and measured after 24 hrs by time kill assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1905564Antimicrobial activity against Enterococcus faecalis ATCC 29212 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID425040Toxicity against human erythrocytes in assay tube containing mixture of erythrocytes/Listeria monocytogenes cells at 40 ug/ml after 30 mins2007Antimicrobial agents and chemotherapy, Nov, Volume: 51, Issue:11
Antimicrobial effect of halocidin-derived peptide in a mouse model of Listeria infection.
AID1516035Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 259232019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1701046Induction of outer membrane re-arragenemnts in Escherichia coli ATCC 25922 incubated for 4 mins by NPN uptake assay2020Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23
Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1887599Bactericidal activity against Staphylococcus aureus ATCC 29213 assessed as increase in extracellular ATP level at 2.5 times MIC after 1 hr by ATP bioluminescence assay2022Journal of natural products, 10-28, Volume: 85, Issue:10
Developing the Natural Prenylflavone Artocarpin from
AID1553784Bactericidal activity against Escherichia coli ATCC 25922 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827084Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1707843Antimicrobial activity against Staphylococcus epidermidis ATCC 12228 after 18 hrs by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553805Fungicidal activity against Candida albicans cgmcc2.2086 assessed as reduction in bacterial growth at MFC by time-kill assay2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1609429Induction of cytoplasmic membrane depolarization in Staphylococcus aureus at 2 times of MIC for a period of 600 sec by DiSC3-5-fluorescence based assay2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1442117Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of KCl by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1369481Antifungal activity against Candida albicans cgmcc 2.2086 in presence of CaCl2 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524072Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of MgCl22019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1905566Antimicrobial activity against Escherichia coli ATCC 25922 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID357101Cytotoxicity against human HeLa cells at 100 ug/ml after 24 hrs by neutral red uptake assay relative to control2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1553779Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1304016Toxicity in human RBC assessed as hemolytic activity at 2 uM measured after 1 hr by spectrophotometric analysis2016Bioorganic & medicinal chemistry, 07-01, Volume: 24, Issue:13
Stable and biocompatible cystine knot peptides from the marine sponge Asteropus sp.
AID1369483Antifungal activity against Candida albicans cgmcc 2.2086 in presence of FeCl3 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1129354Cytotoxicity against human HepG2 cells after 1 hr by MTS/PMS assay2014Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7
Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1827100Hemolytic activity against human RBC assessed as hemoglobin release at pH 6.5 incubated for 1 hrs2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1741115Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516063Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 4 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741133Therapeutic index, ratio of HC10 for sheep RBC to geometric mean MIC for yeast2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1891823Hemolytic activity in human RBC assessed as hemolysis incubated for 1 hr by Neubauer hemocytometer analysis2022Bioorganic & medicinal chemistry, 06-15, Volume: 64Valorisation of the diterpene podocarpic acid - Antibiotic and antibiotic enhancing activities of polyamine conjugates.
AID1507614Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by disC3-5 dye based fluorescence assay2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID710196Antibacterial activity against Micrococcus luteus ATCC 10240 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1516065Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 12 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1442088Antibacterial activity against Pseudomonas aeruginosa CICC 21625 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID710129Antibacterial activity against Salmonella enterica ATCC 13076 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1516059Antibacterial activity against Escherichia coli ATCC 25922 in presence of 12.5% serum by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553775Antibacterial activity against Escherichia coli 078 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735107Antibacterial activity against Salmonella typhimurium CMCC 51005 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1516029Antibacterial activity against Staphylococcus aureus 11011 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516080Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 10 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1527503Antimicrobial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method2020European journal of medicinal chemistry, Jan-01, Volume: 185Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1735142Cytotoxicity against mouse RAW264.7 cells assessed as increase in cell viability at 64 uM incubated for 24 hrs by MTT assay relative to control2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674592Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella typhimurium 140282020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1741132Therapeutic index, ratio of HC10 for sheep RBC to geometric mean MIC for gram negative bacteria2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1661685Antimicrobial activity against Enterococcus faecalis ATCC 29121 assessed as inhibition of microbial growth incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1609359Antibacterial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605813Induction of pore formation in intact Escherichia coli 1004 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1674680Stability of compound assessed as trypsin (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674633Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 1 mM Mg2+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1887600Bactericidal activity against Staphylococcus aureus ATCC 29213 assessed as decrease in intracellular ATP level at 2.5 times MIC after 1 hr by ATP bioluminescence assay2022Journal of natural products, 10-28, Volume: 85, Issue:10
Developing the Natural Prenylflavone Artocarpin from
AID1516019Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707930Induction of membrane disruption in Staphylococcus aureus ATCC 25923 assessed as PI-positive cells at 4 times MIC measured after 2 hrs by propidium iodide staining based flow cytometry relative to control2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1735130Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella enteritidis CICC 215272016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524067Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of KCl2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707867Ratio of MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in presence of 10% serum to MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in absence of serum2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524045Antimicrobial activity against Salmonella pullorum C7913 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1507593Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 after 24 hrs2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1916062Antibacterial activity against Klebsiella pneumoniae ATCC 10031 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1369441Bactericidal activity against Staphylococcus epidermidis ATCC 122282018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704805Increase of VEGFA-stimulated p38 phosphorylation in HUVEC by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1741120Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516071Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of NH4Cl by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516054Antibacterial activity against Escherichia coli ATCC 25922 in presence of NH4Cl by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524126Bactericidal activity against Pseudomonas aeruginosa ATCC 27853 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524056Cytotoxicity against HEK293T cells assessed as cell death after 18 to 24 hrs by MTT assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765622Antibacterial activity against Staphylococcus aureus ATCC 25923 at 0.5 to 1 times MIC incubated for 24 hrs by crystal violet staining based assay2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID458038Toxicity in human RBCs assessed as induction of hemolysis at 20 uM relative to untreated control2010Bioorganic & medicinal chemistry, Mar-01, Volume: 18, Issue:5
Design, synthesis and antimicrobial properties of non-hemolytic cationic alpha-cyclopeptoids.
AID1516033Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella enterica serovar typhimurium C77-312019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369476Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of FeCl3 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1433369Antimicrobial activity against Escherichia coli KCTC 1682 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1765619Antibiofilm activity against Escherichia coli ATCC 25922 at 4 times MIC incubated for 24 hrs by crystal violet staining based assay2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553907Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Candida tropicalis cgmcc2.19752019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID710128Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID309576Cytotoxicity against human erythrocytes assessed as hemolysis at 25 ug/ml2007Bioorganic & medicinal chemistry letters, Nov-01, Volume: 17, Issue:21
Design and synthesis of novel antibacterial peptide-resin conjugates.
AID1516032Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli UB10052019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707858Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of NH4Cl by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID656071Induction of membrane depolarization in Aspergillus fumigatus at 1.56 to 100 uM at pH 5.5 by DiSC3(5)-based fluorescence assay2012Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3
Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1442094Antibacterial activity against Pseudomonas aeruginosa 25349 clinical isolate after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1674604Antibacterial activity against Staphylococcus aureus 11011 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1442095Antibacterial activity against Pseudomonas aeruginosa 26305 clinical isolate after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1442107Binding affinity to Pseudomonas aeruginosa ATCC 27853 LPS by SPR spectroscopic analysis2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1415096Induction of membrane permeabilization in Escherichia coli KCTC 1682 assessed as PI-positive cells at 4 uM after 1 to 2 hrs by propidium iodide-staining based flow cytometry (Rvb = 2.36%)2018Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24
Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1369451Antifungal activity against Candida albicans 14936 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1661686Antimicrobial activity against Escherichia coli ATCC 8739 assessed as inhibition of microbial growth incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1090768Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression progression at 32 uM measured 7 days post fungal inoculation by orange fruit decay assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1553799Fungicidal activity against Candida tropicalis cgmcc2.1975 incubated for 48 hrs followed by replating on YM agar plate and measured after 48 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827096Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1524032Antimicrobial activity against Escherichia coli ATCC 25922 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1741116Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674591Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli UB10052020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369460Fungicidal activity against Candida albicans SP3876 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1609358Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID770114Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1090765Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression progression at 4 uM pre-incubated with fungus for 16 hr measured 7 days post fungal inoculation by orange fruit decay assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID770116Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1553818Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of FeCl32019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516093Induction of cytoplasmic membrane depolarization in Escherichia coli UB1005 at 2 uM by DiSC3-5 dye based fluorescence method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID577693Induction of outer membrane permeabilization of Escherichia coli ML-35p by nitrocefin permeation based spectrophotometric assay2010Antimicrobial agents and chemotherapy, Sep, Volume: 54, Issue:9
Depolarization, bacterial membrane composition, and the antimicrobial action of ceragenins.
AID1516078Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of 50% serum by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516079Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 4 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674638Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 50% human serum by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1741121Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674586Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 292132020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID357104Antibacterial activity against Escherichia coli ATCC 25922 after 24 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID704804Increase of VEGFA-stimulated p38 phosphorylation in HUVEC by Western blot analysis in presence of p38 inhibitor SB2035802012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID770112Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1869119Antimicrobial activity against Staphylococcus aureus KCTC 1621 assessed as minimal inhibitory concentration incubated for 18 hrs2022Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11
Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1539024Antibacterial activity against methicillin-resistant Staphylococcus aureus JCSC 4744 incubated overnight by CLSI protocol based microdilution assay2019Journal of natural products, 07-26, Volume: 82, Issue:7
Callistemonols A and B, Potent Antimicrobial Acylphloroglucinol Derivatives with Unusual Carbon Skeletons from
AID1516057Antibacterial activity against Escherichia coli ATCC 25922 in presence of CaCl2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1412405Induction of membrane disruption in methicillin-sensitive Staphylococcus aureus FDA 209P assessed as increase in K+ efflux after 30 mins2018MedChemComm, Mar-01, Volume: 9, Issue:3
Membrane-active antimicrobial poly(amino-modified alkyl) β-cyclodextrins synthesized
AID1735133Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Staphylococcus aureus GIM 1.1602016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1442089Antibacterial activity against Pseudomonas aeruginosa CICC 21630 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1542766Hemolytic activity against human RBC incubated for 10 mins under shaking condition measured after 1 hr2019Bioorganic & medicinal chemistry, 05-15, Volume: 27, Issue:10
6-Bromoindolglyoxylamido derivatives as antimicrobial agents and antibiotic enhancers.
AID1516082Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of H202 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553815Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of CaCl22019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605808Antibacterial activity against Escherichia coli 1004 assessed as reduction in bacterial viability at 2 or 4 times MIC incubated up to 24 hrs in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time kill kinetics assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1905565Antimicrobial activity against Klebsiella pneumoniae ATCC 700603 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1605794Induction of pore formation in zwitterionic DOPC/cholesterol large unilamellar vesicles assessed as calcein release at 0.39 to 50 uM measured for 60 mins by fluorescence based assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID704814Down regulation of VEGF-A expression in VEGFA-stimulated HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1827094Antibacterial activity against Escherichia coli ATCC 25922 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1741123Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1735112Antibacterial activity against Listeria monocytogenes CICC 21662 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID656072Induction of membrane depolarization in Aspergillus fumigatus at 1.56 to 100 uM at pH 7.5 by DiSC3(5)-based fluorescence assay2012Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3
Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1524078Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 1 mg/ml trypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553860Displacement of BODIPY-TR-cadaverine from Escherichia coli O111:B4 LPS after 1 hr by spectrofluorophotometric method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1442092Antibacterial activity against ceftazidime-resistant Pseudomonas aeruginosa 11431 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1553790Bactericidal activity against Escherichia coli K99 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553783Antifungal activity against Candida tropicalis cgmcc2.1975 measured after 48 hrs by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674605Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674611Antibacterial activity against Staphylococcus epidermidis ATCC 12228 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID48746Minimum inhibitory concentration against Candida albicans ATCC 362322004Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5
Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1707844Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369443Antifungal activity against Candida albicans cgmcc 2.2086 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1433412Antimicrobial activity against Escherichia coli KCTC 1682 using 4 hrs trypsin incubated compound measured after overnight incubation by radial diffusion assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1524064Selectivity ratio of IC50 for HEK293T cells to geometric mean of the peptide MBC for bacteria2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605825Stability of the compound in rabbit tear fluids assessed as parent compound remaining measured after 4 hrs by UPLC-MS analysis2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1674582Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Streptococcus agalactiae H922020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553819Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of NH4Cl2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1691344Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1707925Binding affinity to LPS (unknown origin) assessed as bacterial killing at 2 times MIC preincubated for 1 hr followed by Staphylococcus aureus ATCC 25923 addition and measured after 2 hrs by colony counting method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1609343Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605803Hemolytic activity against human erythrocytes assessed as hemoglobin release incubated for 1 hr2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID577468Antimicrobial activity against Staphylococcus aureus2010Antimicrobial agents and chemotherapy, Oct, Volume: 54, Issue:10
Cationic amphiphiles, a new generation of antimicrobials inspired by the natural antimicrobial peptide scaffold.
AID1674645Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL trypsin for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID770119Hemolytic activity in human RBC assessed as hemoglobin release after 1 hr2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1735151Induction of inner membrane permeabilization in Escherichia coli O157:H7 CICC 21530 assessed as cytoplasmic beta-galactosidase release at 1 times MIC using ONPG as substrate by fluorescence assay2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1553861Displacement of BODIPY-TR-cadaverine from Escherichia coli O111:B4 LPS at 1 to 64 uM after 1 hr by spectrofluorophotometric method relative to control2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827087Antibacterial activity against Escherichia coli ATCC 25922 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1412407Antibacterial activity against Staphylococcus aureus FDA 209P assessed as decrease in cell viability after 30 mins by colony counting method2018MedChemComm, Mar-01, Volume: 9, Issue:3
Membrane-active antimicrobial poly(amino-modified alkyl) β-cyclodextrins synthesized
AID1063813Antibacterial activity against Escherichia coli ATCC 25922 assessed as release of beta-galactosidase after 1 hr relative to control2014Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2
Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1507594Antibacterial activity against Vancomycin-resistant Enterococcus faecium ATCC 51559 after 24 hrs2017European journal of medicinal chemistry, Aug-18, Volume: 136LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1433371Antimicrobial activity against Staphylococcus epidermidis KCTC 1917 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID656070Induction of membrane damage in Aspergillus fumigatus at 1.56 to 100 uM at pH 7.5 by Sytox green-based fluorescence assay2012Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3
Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1827110Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 6.5 in presence of 50% serum2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1609356Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1369487Antifungal activity against Candida albicans cgmcc 2.2086 in presence of 12.5% human heat-inactivated serum by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369456Fungicidal activity against Candida albicans cgmcc 2.2086 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1735141Hemolytic activity against human red blood cells assessed as hemoglobin release at 64 uM measured after 1 hr by microplate reader analysis relative to control2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1516031Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 259222019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1661694Microbicidal activity against Pseudomonas aeruginosa ATCC 9027 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1735126Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella paratyphi C CICC 215122016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674585Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Enterococcus faecalis ATCC 292122020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674606Antibacterial activity against Escherichia coli UB1005 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553829Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of CaCl by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID762049Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition at 50 ug/ml preincubated with trypsin for 1 hr followed by 18 to 20 hrs incubation in bacterial culture by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID704818Cytotoxicity against HUVEC assessed as cell viability at 40 uM after 48 hrs by MTT assay relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369482Antifungal activity against Candida albicans cgmcc 2.2086 in presence of ZnCl2 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524081Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.125 mg/ml trypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1527494Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method2020European journal of medicinal chemistry, Jan-01, Volume: 185Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1423348Cytotoxicity against human HFF1 after 24 hrs by MTT assay2018Journal of natural products, 11-26, Volume: 81, Issue:11
Discovery and Characterization of Cyclotides from Rinorea Species.
AID1369488Antifungal activity against Candida albicans cgmcc 2.2086 in presence of 25% human heat-inactivated serum by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704820Cytotoxicity against HUVEC assessed as cell viability at 10 uM after 48 hrs by MTT assay relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674621Cytotoxicity against mouse RAW264.7 cells assessed as reduction in cell viability lower concentration by MTT assay2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553868Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 assessed as fluorescence intensity at 2 uM up to 3000 secs by DiSC3-5 dye-based fluorescence spectrophotometric method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1090773Antimicrobial activity against Penicillium digitatum PHI-26 assessed as microbial growth inhibition after 4 days by microtiter plate assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID704835Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as tumor growth inhibition at 0.5 mg/kg, sc qd for 18 days relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID770117Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1605793Induction of pore formation in negatively charged DOPE/DOPG large unilamellar vesicles assessed as calcein release at 0.39 to 50 uM measured for 60 mins by fluorescence based assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID704833Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as tumor growth inhibition at 5 mg/kg, sc qd for 18 days relative to control2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1553771Antibacterial activity against Salmonella pullorum ATCC 7913 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516070Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of KCl by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1735139Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Pseudomonas fluorescens CICC 216202016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369472Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of NH4Cl by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369448Antifungal activity against Candida albicans isolated from alveolar fluid after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553832Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of FeCl by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369480Antifungal activity against Candida albicans cgmcc 2.2086 in presence of MgCl2 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID710120Half life in bovine serum2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1707847Antimicrobial activity against methicillin-resistant Staphylococcus aureus 75 after 18 hrs by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1527501Antimicrobial activity against multi drug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method2020European journal of medicinal chemistry, Jan-01, Volume: 185Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1707945Cytotoxicity against HEK293T cells assessed as reduction in cell viability at 1 uM measured after 24 hrs by MTT assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553788Bactericidal activity against Pseudomonas aeruginosa ATCC 27853 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1433380Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3089 after 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1765588Antibacterial activity against bacteria incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1765576Antibacterial activity against Staphylococcus epidermidis ATCC 12228 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID164409Compound was evaluated for antibacterial activity against Pseudomonas aeruginosa1996Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16
De novo antimicrobial peptides with low mammalian cell toxicity.
AID1369477Antifungal activity against Candida albicans cgmcc 2.2086 in presence of NaCl by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553770Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369449Antifungal activity against fluconazole-resistant Candida albicans 56452 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1735104Antibacterial activity against Salmonella paratyphi C CICC 21512 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1707942Induction of nucleic acid leakage in Staphylococcus aureus ATCC 25923 at 4 times MIC2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1674641Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of trypsin by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553830Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of MgCl by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID207641Compound was evaluated for antibacterial activity against Staphylococcus aureus1996Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16
De novo antimicrobial peptides with low mammalian cell toxicity.
AID1674590Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella choleraesuis 5032020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1707863Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of 2.5% serum by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1433370Antimicrobial activity against Pseudomonas aeruginosa KCTC 1637 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1609339Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1433382Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3095 after 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1415095Induction of membrane permeabilization in Staphylococcus aureus KCTC 1621 at 2 times MIC concentration up to 300 secs by SYTOX green uptake assay2018Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24
Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1661683Antimicrobial activity against Bacillus subtilis ATCC 6633 assessed as inhibition of microbial growth incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1553786Bactericidal activity against Salmonella typhimurium ATCC 14028 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID205530Minimum inhibitory concentration against Staphylococcus aureus ATCC 65382004Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5
Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID770110Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition at 50 ug/ml after 18 to 20 hrs by broth microdilution method in presence of trypsin2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1553823Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of MgCl22019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735140Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for methicillin resistant Staphylococcus aureus ATCC 433002016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1741173Induction of cell membrane permeability in Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by DiSC3-5 dye based spectrofluorometry2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516028Antibacterial activity against Pseudomonas aeruginosa 25349 clinical isolate incubated for 18 to 24 hrs by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741117Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516073Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of ZnCl2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674634Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 8 uM Zn2+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553772Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553825Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of FeCl32019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1869112Antimicrobial activity against Escherichia coli KCTC 1682 assessed as minimal inhibitory concentration incubated for 18 hrs2022Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11
Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1516090Induction of outer membrane permeabilization in Escherichia coli UB1005 assessed as increase in NPN uptake at 0.5 to 4 uM by spectrofluorophotometric assay2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674613Antibacterial activity against methicillin-resistant Staphylococcus aureus 43300 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1765595Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for gram-negative bacteria2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1905243Disruption of bacterial cell membrane in Escherichia coli ATCC 25922 assessed as proportion of bacteria with damaged cell membrane at 5X MIC incubated for 1 hr by PI staining based flow cytometric analysis (Rvb = 0.7%)2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
Spermine-Conjugated Short Proline-Rich Lipopeptides as Broad-Spectrum Intracellular Targeting Antibacterial Agents.
AID1553793Bactericidal activity against methicillin-resistant Staphylococcus aureus ATCC 43300 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524039Antimicrobial activity against Pseudomonas aeruginosa CICC 21630 clinical isolates after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID704807Inhibition of VEGFA-stimulated ERK1/2 phosphorylation in HUVEC by Western blot analysis2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1090769Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression at 32 uM pre-incubated with fungal conidia for 16 hr by orange fruit decay assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1609342Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1765611Antibacterial activity against Klebsiella pneumoniae ATCC 700603 incubated with 0.02 ug/ml chymotrypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1369429Antibacterial activity against Salmonella typhimurium ATCC 14028 after 24 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674627Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 6 uM Fe3+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553768Antibacterial activity against Escherichia coli UB1005 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID704825Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as hair loss at 0.5 to 5 mg/kg, sc qd for 7 days2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369534Fungicidal activity against Candida albicans 58288 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID770115Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl2013European journal of medicinal chemistry, Oct, Volume: 68Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1369508Disruption of cytoplasmic membrane electrical potential in Escherichia coli ATCC 25922 at MBC after 800 secs by DiSC3-5 dye-based fluorescence spectrophotometric method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1090770Antimicrobial activity against Escherichia coli DH5[alpha] assessed as microbial growth inhibition after 4 days by microtiter plate assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1741128Antibacterial activity against Gram positive bacteria assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1765582Cytotoxicity against human glomerular mesangial cells incubated for 12 hrs by MTT assay2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1674608Antibacterial activity against Salmonella typhimurium 7731 after 18 to 24 hrs by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524057Cytotoxicity against IPECJ2 cells assessed as cell death after 18 to 24 hrs by MTT assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605835Cytotoxicity against HDF cells assessed as reduction in metabolic activity at 16 ug/ml incubated for 24 hrs by MTS assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1691346Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1735123Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 351502016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1827095Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1691343Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1090772Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression at 32 uM by orange fruit decay assay2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1735116Antibacterial activity against Bacillus pumilus CMCC 63202 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1201457Induction of hemolysis in mouse erythrocytes at 12.5 and 25 ug/ml incubated at 37 degC for 15 mins2015Journal of medicinal chemistry, Apr-09, Volume: 58, Issue:7
Design of a potent antibiotic peptide based on the active region of human defensin 5.
AID1516066Antibacterial activity against Escherichia coli ATCC 25922 in presence of H202 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1442118Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of NH4Cl by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1691352Hemolytic activity in sheep RBC assessed as hemolysis at 4 ug/ml measured after 2 hrs by ELISA relative to control2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1524082Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 4 mg/ml chymotrypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369486Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of 50% human heat-inactivated serum by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1442091Antibacterial activity against gentamicin-resistant Pseudomonas aeruginosa 11421 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID140051Compound was tested for sublethal concentrations in 3T3 mouse fibroblast lysis.1996Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16
De novo antimicrobial peptides with low mammalian cell toxicity.
AID1433372Antimicrobial activity against Staphylococcus aureus KCTC 1621 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1691358Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method2020European journal of medicinal chemistry, May-01, Volume: 193Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1916060Antibacterial activity against Acinetobacter baumannii ATCC 17978 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1701042Induction of outer membrane permeability in Escherichia coli assessed as periplasmic-beta-lactamase release at 5 uM using CENTA2020Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23
Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1605787Cytotoxicity against HDF cells assessed as minimum cytotoxic concentration incubated for 24 hrs by MTS assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1442087Antibacterial activity against Pseudomonas aeruginosa CICC 10419 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1765594Antibacterial activity against Gram-negative bacteria incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1369468Fungicidal activity against Candida parapsilosis cgmcc 2.3989 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674643Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of pepsin by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524043Antimicrobial activity against Salmonella typhimurium ATCC 14028 after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1516052Antibacterial activity against Escherichia coli ATCC 25922 in presence of NaCl by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1916056Antibacterial activity against methicillin-resistant Staphylococcus aureus NCTC10442 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1674694Induction of outer membrane permeabilization in Escherichia coli ATCC 25922 after 30 mins by NPN-dye based assay2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1527500Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method2020European journal of medicinal chemistry, Jan-01, Volume: 185Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1707854Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for methicillin-resistant Staphylococcus aureus 752021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID710131Antibacterial activity against Listeria monocytogenes SOR 100 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1674584Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for methicillin-resistant Staphylococcus aureus 433002020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1063816Antibacterial activity against Escherichia coli by broth microdilution method2014Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2
Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1553892Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli ATCC 259222019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735108Antibacterial activity against Salmonella enteritidis CICC 21527 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674615Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 150 mM Na+ by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524134Bactericidal activity against Salmonella pullorum C7913 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369489Antifungal activity against Candida albicans cgmcc 2.2086 in presence of 50% human heat-inactivated serum by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707928Induction of cytoplasmic membrane disruption in Staphylococcus aureus ATCC 25923 measured for 15 mins by DiSC3-5 dye based fluorescence assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1129356Cytotoxicity against mouse NIH/3T3 cells after 1 hr by MTS/PMS assay2014Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7
Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1369467Fungicidal activity against Candida krusei cgmcc 2.1857 after 96 hrs2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1516095Inhibition of swimming motility of Escherichia coli ATCC 25922 at 1 to 4 uM after 16 hrs2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1569930Hemolytic activity in human Erythrocyte at 1 uM measured after 1 hr relative to control2019European journal of medicinal chemistry, Oct-15, Volume: 180Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID1553903Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Staphylococcus aureus ATCC 259232019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524084Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 1 mg/ml chymotrypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553792Bactericidal activity against Salmonella typhimurium C7731 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524071Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of NH4Cl2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1433376Therapeutic index, ratio of MHC for sheep RBC to MIC for Staphylococcus epidermidis KCTC 19172017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1369440Bactericidal activity against methicillin-resistant Staphylococcus aureus ATCC 43302018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553870Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 assessed as increase in ONPG release at 1 to 64 uM measured at 6 mins interval for 120 mins by spectroscopically2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1090766Fungicidal activity against Penicillium digitatum PHI-26 conidia assessed as reduction in conidia viability at 4 uM incubated for 16 hr by colony count assay relative to untreated control2007Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20
Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1423349Cytotoxicity against human MM96L after 24 hrs by MTT assay2018Journal of natural products, 11-26, Volume: 81, Issue:11
Discovery and Characterization of Cyclotides from Rinorea Species.
AID1524123Bactericidal activity against Escherichia coli 078 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1415094Induction of membrane permeabilization in Staphylococcus aureus KCTC 1621 at 2 to 8 times MIC concentration up to 300 secs by SYTOX green uptake assay2018Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24
Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1524125Bactericidal activity against Escherichia coli K99 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553899Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli 0782019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827099Hemolytic activity in human RBC assessed as hemoglobin release at pH 7.4 incubated for 1 hr2022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1553781Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs by broth microdilution method2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735109Antibacterial activity against Vibrio parahaemolyticus CICC 21617 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1442121Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of FeCl3 by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1916061Antibacterial activity against Acinetobacter baumannii R2889 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1707860Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of CaCl2 by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID704828Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as mortality at 0.5 to 5 mg/kg, sc qd for 18 days2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID710195Antibacterial activity against Lactococcus garvieae ATCC 43921 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1369469Hemolytic activity in human RBC after 1 hr2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707848Antimicrobial activity against methicillin-resistant Staphylococcus aureus 113 after 18 hrs by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553794Bactericidal activity against Staphylococcus epidermidis ATCC 12228 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735117Antibacterial activity against Pseudomonas fluorescens CICC 21620 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1735124Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella paratyphi A CICC 205012016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1553791Bactericidal activity against Escherichia coli 078 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1433384Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 after 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1369435Bactericidal activity against Escherichia coli ATCC 259222018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524070Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of FeCl32019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674630Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 100% human serum by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524047Antimicrobial activity against Klebsiella pneumoniae after 24 hrs by NCCLS-protocol based assay2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524145Stability of the compound assessed as chymotrypsin (unknown origin)-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674644Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of proteinase K by CLSI-based broth microdilution method2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID654512Induction of apoptosis in human activated PBMC assessed as necrotic cells at 1.6 uM by annexinV/propidium iodide staining-based flow cytometric analysis2012Journal of natural products, Feb-24, Volume: 75, Issue:2
Do plant cyclotides have potential as immunosuppressant peptides?
AID1524074Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 25% serum albumin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID357100Cytotoxicity against human HeLa cells at 100 ug/ml after 24 hrs by MTT assay relative to control2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1707857Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of KCl by broth microdilution method2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516117Antibacterial activity against Pseudomonas aeruginosa PAO1 at sub-MIC treated over 35 serial passages by resistant development assay2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1701047Induction of outer membrane re-arragenemnts in Escherichia coli D21f2 incubated for 4 mins by NPN uptake assay2020Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23
Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1524068Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of CaCl22019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765577Antibacterial activity against Escherichia coli ATCC 25922 incubated for 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1516060Antibacterial activity against Escherichia coli ATCC 25922 in presence of 25% serum by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1661691Microbicidal activity against Staphylococcus aureus ATCC 6538 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1553901Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against methicillin-resistant Staphylococcus aureus ATCC 433002019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735100Antibacterial activity against Escherichia coli ATCC 25922 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524136Bactericidal activity against Klebsiella pneumoniae incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1916058Hemolytic activity in rabbit RBC measured after 1 hrs by multimode reader assay
AID1369533Antifungal activity against Candida albicans 58288 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707866Ratio of MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in presence of 5% serum to MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in absence of serum2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID409501Toxicity in human erythrocytes assessed as hemolytic activity at 3.5 uM2008Journal of medicinal chemistry, Dec-25, Volume: 51, Issue:24
Engineering stabilized vascular endothelial growth factor-A antagonists: synthesis, structural characterization, and bioactivity of grafted analogues of cyclotides.
AID1569926Antibacterial activity against Bacillus subtilis 168 HT assessed as reduction in bacterial cell growth incubated for 24 hrs by microtiter dilution method2019European journal of medicinal chemistry, Oct-15, Volume: 180Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID1516068Antibacterial activity against Staphylococcus aureus ATCC 29213 using preheated compound at 100 degreeC for 1 hr by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1661692Microbicidal activity against Enterococcus faecalis ATCC 29121 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID704803Down regulation of VEGFA-stimulated COX2 expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis in presence of p38 inhibitor SB2035802012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1524062Selectivity ratio of HC10 for human RBC to geometric mean of the peptide MBC for bacteria2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1741114Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID710130Antibacterial activity against Escherichia coli ATCC 25922 after 48 hrs by microtiter broth dilution method2012Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24
De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID378686Toxicity against human type A red blood cells assessed as hemolytic activity after 1hr2006Journal of natural products, Jan, Volume: 69, Issue:1
Cycloviolacin H4, a hydrophobic cyclotide from Viola hederaceae.
AID1553773Antibacterial activity against Escherichia coli K88 measured after 24 hrs2019Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9
Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516051Antibacterial activity against Escherichia coli ATCC 25922 using preheated compound at 100 degreeC for 1 hr by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707878Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at MIC preincubated for 4 hrs followed by replating on MHB agar and measured after 24 hrs by time kill assay2021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369453Antifungal activity against Candida tropicalis cgmcc 2.1975 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765593Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for gram positive bacteria2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1369475Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of ZnCl2 by broth dilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1605812Induction of pore formation in intact Acinetobacter baumannii 1001 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID704823Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as mortality at 0.5 to 5 mg/kg, sc qd for 7 days2012Journal of natural products, Nov-26, Volume: 75, Issue:11
Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID131991Concentration required for half-maximal lysis of mouse erythrocytes; NA = not active2004Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5
Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1605843Cytotoxicity against HDF cells assessed as minimum cytotoxic concentration incubated for 24 hrs by Alexa Fluor 569 phalloidin-FITC/Hoescht dye staining based fluorescence microscopic analysis2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1707853Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Bacillus subtilis ATCC 238572021European journal of medicinal chemistry, Feb-15, Volume: 212Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516058Antibacterial activity against Escherichia coli ATCC 25922 in presence of FeCl3 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1129358Hemolytic activity in human RBC after 1 hr2014Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7
Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1369509Disruption of cytoplasmic membrane electrical potential in Candida albicans cgmcc 2.2086 at MFC after 800 secs by DiSC3-5 dye-based fluorescence spectrophotometric method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674618Hemolytic activity in human RBC assessed as hemolysis at 1 uM relative to control2020Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17
Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1469647Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs by microdilution method2018Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7
Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1735110Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method2016Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24
Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524083Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 2 mg/ml chymotrypsin2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1423351Cytotoxicity against human HT-29 after 24 hrs by MTT assay2018Journal of natural products, 11-26, Volume: 81, Issue:11
Discovery and Characterization of Cyclotides from Rinorea Species.
AID1369444Antifungal activity against Candida albicans SP3931 after 48 hrs by broth microdilution method2018Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9
Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1442084Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs by broth microdilution method2017Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6
Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1516084Resistance index, ratio of MIC for antibacterial activity against Escherichia coli ATCC 25922 treated over 35 serial passage by sequential passaging method to MIC for antibacterial activity against Escherichia coli ATCC 25922 incubated for 18 to 24 hrs by2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516072Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of MgCl2 by broth microdilution method2019Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15
Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524053Ratio of MBC against Pseudomonas aeruginosa ATCC 27853 after 50 passages to MBC against Pseudomonas aeruginosa ATCC 278532019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1415093Induction of cytoplasmic membrane depolarization in Staphylococcus aureus KCTC 1621 at 2 times MIC concentration by DiSC3(5)-dye based fluorescence spectrophotometry2018Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24
Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1433397Induction of cytoplasmic membrane depolarization in Staphylococcus aureus KCTC 1621 assessed as loss of membrane potential after 1 hr by DiSC3(5) dye based fluorescence assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID357107Antibacterial activity against Brucella abortus 9.49 (per-) after 48 hrs in Mueller-Hinton broth medium2007The Journal of biological chemistry, May-18, Volume: 282, Issue:20
Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID91128Compound was measured for sublethal concentrations (uM) in Human erythrocytes1996Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16
De novo antimicrobial peptides with low mammalian cell toxicity.
AID1827112Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 7.4 in presence of CaCl22022Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7
pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1605809Antibacterial activity against Klebsiella pneumoniae 1008 assessed as reduction in bacterial viability at 2 or 4 times MIC incubated up to 24 hrs in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time kill kinetics assay2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1741126Antifungal activity against Candida albicans KCTC 7121 assessed as reduction in fungal growth incubated for 24 hrs by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1524122Bactericidal activity against Escherichia coli UB1005 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524063Selectivity ratio of IC50 for mouse RAW264.7 cells to geometric mean of the peptide MBC for bacteria2019Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5
Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605804Antibacterial activity against vancomycin-resistant Enterococcus faecalis ATCC 29212 assessed as log10 reduction in bacterial viability at 2 to 4 times MIC incubated for 30 mins in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by t2020Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7
Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1469687Induction of membrane permeabilization in Escherichia coli ATCC 25922 assessed as loss of pili/flagella at MBC after 1 hr by atomic force microscopic method2018Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7
Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1765608Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated with 0.02 ug/ml trypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023]

Research

Studies (68)

TimeframeStudies, This Drug (%)All Drugs %
pre-19903 (4.41)18.7374
1990's1 (1.47)18.2507
2000's8 (11.76)29.6817
2010's35 (51.47)24.3611
2020's21 (30.88)2.80
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Market Indicators

Research Demand Index: 23.01

According to the monthly volume, diversity, and competition of internet searches for this compound, as well the volume and growth of publications, there is estimated to be moderate demand-to-supply ratio for research on this compound.

MetricThis Compound (vs All)
Research Demand Index23.01 (24.57)
Research Supply Index4.23 (2.92)
Research Growth Index5.74 (4.65)
Search Engine Demand Index39.83 (26.88)
Search Engine Supply Index4.00 (0.95)

This Compound (23.01)

All Compounds (24.57)

Study Types

Publication TypeThis drug (%)All Drugs (%)
Trials0 (0.00%)5.53%
Reviews4 (5.88%)6.00%
Case Studies0 (0.00%)4.05%
Observational0 (0.00%)0.25%
Other64 (94.12%)84.16%
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]
chemdatabank.com