forapin profile

Forapin: used as ointment for treatment of myositis & arthritis; contains bee venom, salicylate, nicotinate & vanillylnonamide [Medical Subject Headings (MeSH), National Library of Medicine, extracted Dec-2023]

ID Source	ID
PubMed CID	16133648
CHEMBL ID	412927
CHEBI ID	6736
MeSH ID	M0109556

Synonym
gigavlkvlttglpaliswikrkrqq-nh2
forapin
bee venom melittin
melittin (apis cerana)
melittin (major)
forapine
honeybee melittin
g-i-g-a-v-l-k-v-l-t-t-g-l-p-a-l-i-s-w-i-k-r-k-r-q-q-nh2
melittin from honey bee venom, >=85% (hplc)
melittin, >=97% (hplc), synthetic
NCGC00167171-01
CHEMBL412927
chebi:6736 ,
24vt8nve75 ,
unii-24vt8nve75
RS-2008
melittin (gigavlkvlttglpaliswikrkrqq-amide)
VDXZNPDIRNWWCW-JFTDCZMZSA-N
gly-ile-gly-ala-val-leu-lys-val-leu-thr-thr-gly-leu-pro-ala-leu-ile-ser-trp-ile-lys-arg-lys-arg-gln-gln-nh2
gly-l-ile-gly-l-ala-l-val-l-leu-l-lys-l-val-l-leu-l-thr-l-thr-gly-l-leu-l-pro-l-ala-l-leu-l-ile-l-ser-l-trp-l-ile-l-lys-l-arg-l-lys-l-arg-l-gln-l-gln-nh2
glycyl-l-isoleucylglycyl-l-alanyl-l-valyl-l-leucyl-l-lysyl-l-valyl-l-leucyl-l-threonyl-l-threonylglycyl-l-leucyl-l-prolyl-l-alanyl-l-leucyl-l-isoleucyl-l-seryl-l-tryptophyl-l-isoleucyl-l-lysyl-l-arginyl-l-lysyl-l-arginyl-l-glutaminyl-l-glutamamide
AC-32561
AKOS024456456
mfcd00076868
melittin from honey bee venom, >=65% (hplc)
EX-A7430
XM176021
melittin tfa
DTXSID001046261

Excerpt	Reference	Relevance
" Two modified melittin peptides displayed rapid bactericidal properties against antibiotic-resistant strains, low innate resistance development by pathogenic bacteria, remained nonimmunogenic for T lymphocytes, and increased bioavailability in tear fluids."	( Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin. Agrawal, R; Barathi, VA; Beuerman, RW; Chan, LW; Jie, TY; Koh, SK; Lakshminarayanan, R; Leng, ET; Mayandi, V; Sebastian, TM; Somaraju Chalasani, ML; Ting, DSJ; Urf Turabe Fazil, MH; Varadarajan, J; Verma, NK; Xi, Q; Zhou, L, 2020)	0.56

Role	Description
animal metabolite	Any eukaryotic metabolite produced during a metabolic reaction in animals that include diverse creatures from sponges, insects to mammals.
venom	A toxin used by animals and injected into their victims by a bite or sting.
EC 2.7.11.13 (protein kinase C) inhibitor	An EC 2.7.11.* (protein-serine/threonine kinase) inhibitor that interferes with the action of protein kinase C (EC 2.7.11.13).
hepatoprotective agent	Any compound that is able to prevent damage to the liver.
apoptosis inducer	Any substance that induces the process of apoptosis (programmed cell death) in multi-celled organisms.
neuroprotective agent	Any compound that can be used for the treatment of neurodegenerative disorders.
antineoplastic agent	A substance that inhibits or prevents the proliferation of neoplasms.
[role information is derived from Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Class	Description
polypeptide	A peptide containing ten or more amino acid residues.
peptidyl amide	A peptide that has a carbamoyl group at the C-terminus.
[compound class information is derived from Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Pathway	Proteins	Compounds
Spinal cord injury	0	8

Protein	Taxonomy	Measurement	Average (µ)	Min (ref.)	Avg (ref.)	Max (ref.)	Bioassay(s)
phosphopantetheinyl transferase	Bacillus subtilis	Potency	35.4813	0.1413	37.9142	100.0000	AID1490
heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)	Homo sapiens (human)	Potency	15.8489	0.0165	25.3078	41.3999	AID602332
nuclear receptor ROR-gamma isoform 1	Mus musculus (house mouse)	Potency	3.9151	0.0079	8.2332	1,122.0200	AID2546; AID2551
[prepared from compound, protein, and bioassay information from National Library of Medicine (NLM), extracted Dec-2023]

Bioassays (849)

Assay ID	Title	Year	Journal	Article
AID1691361	Antimicrobial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1605841	Induction of pore formation in negatively charged DOPE/DOPG large unilamellar vesicles assessed as ratio of peptide to lipid molar ratio that induces 50% calcein leakage measured for 60 mins by calcein dequenching based fluorescence based assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1524038	Antimicrobial activity against Pseudomonas aeruginosa PAO1 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707845	Antimicrobial activity against Staphylococcus aureus ATCC 29213 after 18 hrs by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553820	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of NaCl	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516027	Antibacterial activity against Acinetobacter baumannii AB1902 clinical isolate incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524073	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 50% serum albumin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1916054	Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1524061	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524087	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.125 mg/ml chymotrypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1691359	Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1735128	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella choleraesuis ATCC 13312	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369437	Bactericidal activity against Salmonella typhimurium ATCC 14028	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704831	Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as reduction of body weight at 0.5 to 5 mg/kg, sc qd for 18 days	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1707931	Induction of membrane disruption in Staphylococcus aureus ATCC 25923 assessed as PI-positive cells at 2 times MIC measured after 2 hrs by propidium iodide staining based flow cytometry relative to control	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID704830	Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as lethargy at 0.5 to 5 mg/kg, sc qd for 18 days	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1553789	Bactericidal activity against Escherichia coli K88 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1433381	Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3090 after 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1442105	Drug uptake in Pseudomonas aeruginosa ATCC 27853 treated with FITC-labeled compound at MIC after 30 mins by confocal fluorescence microscopy	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1524036	Antimicrobial activity against Escherichia coli K99 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1661687	Antimicrobial activity against Pseudomonas aeruginosa ATCC 9027 assessed as inhibition of microbial growth incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1553906	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Candida parapsilosis cgmcc2.3989	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707926	Binding affinity to LTA (unknown origin) assessed as bacterial killing at 2 times MIC preincubated for 1 hr followed by Staphylococcus aureus ATCC 25923 addition and measured after 2 hrs by colony counting method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1732432	Haemolytic activity against human whole blood after 70 mins by monochromator plate reader	2021	Bioorganic & medicinal chemistry letters, 05-01, Volume: 39	Design, synthesis and bioactivity evaluation of novel pyrazole linked phenylthiazole derivatives in context of antibacterial activity.
AID1674632	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 4.5 mM K+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735137	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Micrococcus luteus CMCC 28001	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674682	Stability of compound assessed as pepsin (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369497	Induction of cell wall permeabilization in Escherichia coli ATCC 25922 assessed as increase in NPN uptake at 1 to 32 uM by fluorescence spectrophotometric method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID762050	Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition at 50 ug/ml preincubated with trypsin for 1 hr followed by 18 to 20 hrs incubation in bacterial culture by broth microdilution method	2013	Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16	Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID1433413	Antimicrobial activity against Staphylococcus aureus KCTC 1621 using 4 hrs trypsin incubated compound measured after overnight incubation by radial diffusion assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1415105	Hemolytic activity in sheep RBC assessed as free hemoglobin level at 16 uM by ELISA relative to control	2018	Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24	Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1765589	Antibacterial activity against fungi incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1741129	Antibacterial activity against Gram negative bacteria assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1507613	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as cell membrane disruption at 2 times MIC within 4 mins by Sytox Green dye based fluorescence spectrophotometer assay	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1524042	Antimicrobial activity against Pseudomonas aeruginosa 25349 clinical isolates after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1063815	Toxicity in human RBC assessed as hemolysis by measuring hemoglobin release at 1 uM after 1 hr	2014	Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2	Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1691345	Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1369473	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of MgCl2 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707862	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of FeCl3 by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1905242	Disruption of bacterial cell membrane in Escherichia coli ATCC 25922 assessed as proportion of bacteria with intact cell membrane at 5X MIC incubated for 1 hr by PI staining based flow cytometric analysis (Rvb = 99.3%)	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Spermine-Conjugated Short Proline-Rich Lipopeptides as Broad-Spectrum Intracellular Targeting Antibacterial Agents.
AID704824	Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as lethargy at 0.5 to 5 mg/kg, sc qd for 7 days	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674617	Hemolytic activity in human RBC assessed as hemolysis at 1 to 128 uM relative to control	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369459	Fungicidal activity against Candida albicans SP3902 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1415107	Cytotoxicity against mouse RAW264.7 cells at 32 uM after 48 hrs by MTT assay relative to control	2018	Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24	Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1707856	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of NaCl by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369442	Bactericidal activity against Staphylococcus aureus ATCC 25923	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704817	Antiangiogenic activity against VEGFA-stimulated cell proliferation in HUVEC after 48 hrs by BrdU incorporation assay	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1140123	Toxicity in erythrocytes (unknown origin) assessed as hemolytic activity	2014	Journal of natural products, Apr-25, Volume: 77, Issue:4	Antimicrobial peptides from skin secretions of Hypsiboas pulchellus (Anura: Hylidae).
AID1469697	Cytotoxicity against human peripheral blood leukocytes assessed as cell viability at 0.18 uM after 24 hrs by acridine orange/ethidium bromide staining based fluorescence microscopic method relative to control	2018	Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7	Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID704829	Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as hair loss at 0.5 to 5 mg/kg, sc qd for 18 days	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369479	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of NH4Cl by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553828	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of KCl by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553902	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Staphylococcus epidermidis ATCC 12228	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707855	Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for methicillin-resistant Staphylococcus aureus 113	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1827088	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1674593	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 25922	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369504	Binding affinity to phosphatidylglycerol/cardiolipin/phosphatidylethanolamine large unilamellar vesicle assessed as induction of calcein leakage at 2 to 32 uM after 15 mins by spectrofluorophotometric method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID357110	Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1524128	Bactericidal activity against Pseudomonas aeruginosa CICC 21630 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674628	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 25% human serum by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553813	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of NaCl	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524144	Stability of the compound assessed as trypsin (unknown origin)-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID656069	Induction of membrane damage in Aspergillus fumigatus at 1.56 to 100 uM at pH 5.5 by Sytox green-based fluorescence assay	2012	Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3	Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1707929	Induction of membrane disruption in Staphylococcus aureus ATCC 25923 measured after 2 hrs by propidium iodide staining based confocal laser scanning microscopic analysis	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1423347	Cytotoxicity against HUVEC after 24 hrs by MTT assay	2018	Journal of natural products, 11-26, Volume: 81, Issue:11	Discovery and Characterization of Cyclotides from Rinorea Species.
AID704826	Antiangiogenic activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of vessel formation at 5 mg/kg, sc qd for 7 days relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1741174	Induction of cell membrane permeability in Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by SYTOX dye based fluorescence assay	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1063817	Antibacterial activity against Staphylococcus aureus by broth microdilution method	2014	Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2	Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1442085	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1516086	Resistance index, ratio of MIC for antibacterial activity against ciprofloxacin-resistant Escherichia coli to MIC for Escherichia coli ATCC 25922 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369458	Fungicidal activity against Candida albicans SP3903 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765580	Antibacterial activity against Acinetobacter baumannii ATCC 19606 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1516074	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of CaCl2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID704832	Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of tumor weight at 5 mg/kg, sc qd for 18 days relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369436	Bactericidal activity against Escherichia coli 1005	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID163107	Minimum inhibitory concentration against Pseudomonas aeruginosa ATCC 9027	2004	Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5	Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1827093	Antibacterial activity against Salmonella typhimurium ATCC 14028 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1735131	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Vibrio parahaemolyticus CICC 21617	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1691357	Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Staphylococcus aureus KCTC 1621	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1827089	Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1691360	Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1553895	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Salmonella pullorum ATCC 7913	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735111	Antibacterial activity against Staphylococcus aureus GIM 1.160 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1735138	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Bacillus pumilus CMCC 63202	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1516056	Antibacterial activity against Escherichia coli ATCC 25922 in presence of ZnCl2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1809834	Disruption of membrane integrity in human RBC cells assessed as membrane damage at 150 uM incubated for 15 min by Alexa fluor-annexin V staining based assay (Rvb = 0%)	2021	Journal of medicinal chemistry, 10-28, Volume: 64, Issue:20	Tandem Repeat of a Short Human Chemerin-Derived Peptide and Its Nontoxic d-Lysine-Containing Enantiomer Display Broad-Spectrum Antimicrobial and Antitubercular Activities.
AID1516041	Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553896	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Pseudomonas aeruginosa ATCC 27853	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1741119	Antibacterial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1605795	Antibacterial activity against methicillin-sensitive Staphylococcus aureus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1369454	Antifungal activity against Candida krusei cgmcc 2.1857 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID656064	Stability of the compound at 1 ug/uL after 2 hrs by RP-HPLC analysis in presence of proteinase K	2012	Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3	Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1553893	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli UB1005	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369434	Antibacterial activity against Staphylococcus aureus ATCC 25923 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553814	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of KCl	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID425067	Antibacterial activity against Listeria monocytogenes ATCC 19111 in assay tube containing mixture of erythrocyte/Listeria monocytogenes cells assessed as logarithmic reduction in CFU after 30 mins	2007	Antimicrobial agents and chemotherapy, Nov, Volume: 51, Issue:11	Antimicrobial effect of halocidin-derived peptide in a mouse model of Listeria infection.
AID1916059	Antibacterial activity against Pseudomonas aeruginosa ATCC 9027 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID770122	Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID357108	Antibacterial activity against Pseudomonas aeruginosa CUN 4158-02 after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1609338	Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605807	Antibacterial activity against Acinetobacter baumannii 1001 assessed as reduction in bacterial viability at 2 or 4 times MIC incubated up to 24 hrs in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time kill kinetics assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1741109	Cytotoxicity against mouse RAW264.7 cells assessed as reduction in cell viability at 20 uM incubated for 24 hrs by MTT assay	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1765609	Antibacterial activity against Klebsiella pneumoniae ATCC 700603 incubated with 0.02 ug/ml trypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553833	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of NH4Cl by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524066	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of NaCl	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707859	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of MgCl2 by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516053	Antibacterial activity against Escherichia coli ATCC 25922 in presence of KCl by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674635	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 6 uM NH4+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735127	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Shigella flexneri CMCC 51571	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1553798	Fungicidal activity against Candida parapsilosis cgmcc2.3989 incubated for 48 hrs followed by replating on YM agar plate and measured after 48 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674681	Stability of compound assessed as chymotrypsin (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1516055	Antibacterial activity against Escherichia coli ATCC 25922 in presence of MgCl2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369464	Fungicidal activity against Candida albicans 14936 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1129352	Cytotoxicity against human HeLa cells after 1 hr by MTS/PMS assay	2014	Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7	Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1553782	Antifungal activity against Candida parapsilosis cgmcc2.3989 measured after 48 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735105	Antibacterial activity against Shigella flexneri CMCC 51571 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1661689	Hemolytic activity in human RBC assessed as induction of hemolysis incubated for 1 hr	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1707864	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of 5% serum by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID357112	Antibacterial activity against Escherichia coli K12 ATCC 23716 after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1827085	Antibacterial activity against Salmonella enterica subsp. enterica serovar Typhimurium C77-31 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1605789	Antibacterial activity against Staphylococcus aureus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1735113	Antibacterial activity against Listeria monocytogenes CICC 21633 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1741111	Cytotoxicity against mouse RAW264.7 cells assessed as reduction in cell viability at 1.25 to 80 uM incubated for 24 hrs by MTT assay	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1735134	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Listeria monocytogenes CICC 21662	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1707850	Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Staphylococcus epidermidis ATCC 12228	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1765610	Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated with 0.02 ug/ml chymotrypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553824	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of ZnCl2	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1442119	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of ZnCl2 by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID654511	Induction of apoptosis in human activated PBMC assessed as internucleosomal DNA fragmentation at 1.6 uM by annexinV/propidium iodide staining-based flow cytometric analysis	2012	Journal of natural products, Feb-24, Volume: 75, Issue:2	Do plant cyclotides have potential as immunosuppressant peptides?
AID1707851	Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 25923	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369503	Binding affinity to phosphatidylcholine/cholesterol large unilamellar vesicle assessed as induction of calcein leakage at 2 to 32 uM after 15 mins by spectrofluorophotometric method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369465	Fungicidal activity against fluconazole-resistant Candida albicans 17546 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674583	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus epidermidis ATCC 12228	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID704834	Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of tumor weight at 0.5 mg/kg, sc qd for 18 days relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674690	Stability of compound assessed as pepsin (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1605790	Antifungal activity against Candida albicans assessed as reduction in fungal growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1735115	Antibacterial activity against Micrococcus luteus CMCC 28001 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369470	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of NaCl by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1423352	Hemolytic activity against human RBC after 1 hr	2018	Journal of natural products, 11-26, Volume: 81, Issue:11	Discovery and Characterization of Cyclotides from Rinorea Species.
AID1661684	Antimicrobial activity against Staphylococcus aureus ATCC 6538 assessed as inhibition of microbial growth incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1765575	Antibacterial activity against Enterococcus faecalis ATCC 29212 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1442086	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID704816	Antiangiogenic activity against VEGFA-stimulated capillary differentiation in HUVEC after 18 hrs by matrigel assay	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1605824	Stability of the compound in rabbit tear fluid measured after 2 hrs by UPLC-MS analysis	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1674646	Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL chymotrypsin for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1609357	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1827083	Antibacterial activity against Staphylococcus epidermidis ATCC 12228 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1674642	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of chymotrypsin by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524131	Bactericidal activity against Pseudomonas aeruginosa 25349 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1827092	Antibacterial activity against Salmonella enterica subsp. enterica serovar Typhimurium C77-31 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1516085	Antibacterial activity against ciprofloxacin-resistant Escherichia coli ATCC 25922 incubated for 18 to 24 hrs	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741118	Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1413644	Induction of membrane disruption in methicillin-resistant Staphylococcus aureus JCSC 4788 assessed as increase in fluorescence intensity at 0.25 to 8 ug/ml measured after 3 hrs by SYTOX green dye based fluorescence assay	2018	MedChemComm, Oct-01, Volume: 9, Issue:10	Structural optimization and antibacterial evaluation of rhodomyrtosone B analogues against MRSA strains.
AID1469657	Bactericidal activity against Escherichia coli ATCC 25922 after 18 hrs by microdilution method	2018	Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7	Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1369474	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of CaCl2 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1516087	Displacement of BODIPY-TR-cadaverine from Escherichia coli O111:B4 LPS by spectrofluorophotometric method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1569925	Antibacterial activity against Escherichia coli MG1655 assessed as reduction in bacterial cell growth incubated for 24 hrs by microtiter dilution method	2019	European journal of medicinal chemistry, Oct-15, Volume: 180	Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID1516083	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of NaBH4 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID770124	Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1674636	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 6 uM Fe3+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735132	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 29213	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1741113	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID357113	Antibacterial activity against Escherichia coli K12 ATCC 23716 in 10% Luria-Bertani medium/90% Hepes buffer at pH 7.0	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1442093	Antibacterial activity against Pseudomonas aeruginosa 21328 clinical isolate after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1369431	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1701043	Induction of inner membrane permeability in Escherichia coli assessed as cytoplasmic beta-galactosidase release at 5 uM using ONPG	2020	Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23	Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1369463	Fungicidal activity against fluconazole-resistant Candida albicans 56214 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369433	Antibacterial activity against Staphylococcus epidermidis ATCC 12228 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1735129	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella typhimurium CMCC 51005	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674610	Antibacterial activity against Salmonella choleraesuis 503 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369446	Antifungal activity against Candida albicans SP3902 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553795	Bactericidal activity against Staphylococcus aureus ATCC 25923 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1609430	Induction of cytoplasmic membrane depolarization in Staphylococcus aureus at 2 times of MIC within 4 mins by SYTOX green-based assay	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605805	Antibacterial activity against vancomycin-resistant Enterococcus faecalis 1010 assessed as log10 reduction in bacterial viability at 2 to 4 times MIC incubated for 30 mins in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time ki	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1516025	Antibacterial activity against Escherichia coli 20411 clinical isolate incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1827090	Antibacterial activity against Staphylococcus epidermidis ATCC 12228 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1553774	Antibacterial activity against Escherichia coli K99 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1507590	Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3090 after 24 hrs	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1827102	Cytotoxicity against mouse RAW264.7 cells assessed as inhibition of cell growth at pH 7.4 measured after 24 hrs by MTT assay	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1701048	Induction of cell killing in Escherichia coli assessed as time needed for bacterial destruction at 128 ug/ml	2020	Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23	Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1553797	Fungicidal activity against Candida albicans cgmcc2.2086 incubated for 48 hrs followed by replating on YM agar plate and measured after 48 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369427	Antibacterial activity against Escherichia coli ATCC 25922 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704822	Cytotoxicity against HUVEC assessed as cell viability at 1 uM after 48 hrs by MTT assay relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID577465	Toxicity in RBC assessed as hemolysis	2010	Antimicrobial agents and chemotherapy, Oct, Volume: 54, Issue:10	Cationic amphiphiles, a new generation of antimicrobials inspired by the natural antimicrobial peptide scaffold.
AID1369471	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of KCl by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707941	Induction of reactive oxygen species generation in Staphylococcus aureus ATCC 25923 by DCFH-DH dye based fluorescence assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553777	Antibacterial activity against Staphylococcus epidermidis ATCC 12228 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674603	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1442096	Cytotoxicity in mouse RAW264.7 cells after 24 hrs by MTT assay	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1516076	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of 12.5% serum by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID710199	Antibacterial activity against Bacillus megaterium ATCC 10778 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1674625	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 8 uM Zn2+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369438	Bactericidal activity against Salmonella pullorum ATCC 7913	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704815	Down regulation of VEGFR2 expression in VEGFA-stimulated HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674631	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 150 mM Na+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1707865	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of 10% serum by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553905	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Candida albicans cgmcc2.2086	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553807	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 at sub-MBC measured after 17 serial passages	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674624	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 1 mM Mg2+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1740177	Hemolytic activity in human RBC preincubated for 10 mins under shaking condition and measured after 1 hr	2020	European journal of medicinal chemistry, Sep-01, Volume: 201	Synthesis, antibacterial and antifungal activity of new 3-biphenyl-3H-Imidazo[1,2-a]azepin-1-ium bromides.
AID1616109	Inhibition of F1F0-ATP synthase in Escherichia coli	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	Recent advancements in mechanistic studies and structure activity relationship of F
AID1524129	Bactericidal activity against Pseudomonas aeruginosa 26305 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369498	Induction of cell wall permeabilization in Candida albicans cgmcc 2.2086 assessed as increase in NPN uptake at 1 to 32 uM by fluorescence spectrophotometric method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1539038	Disruption of membrane integrity in methicillin-reisitant Staphylococcus aureus JCSC 4744 at 10 ug/ml measured within 2 mins by SYTOX-greeen-based fluorescence assay	2019	Journal of natural products, 07-26, Volume: 82, Issue:7	Callistemonols A and B, Potent Antimicrobial Acylphloroglucinol Derivatives with Unusual Carbon Skeletons from
AID1516077	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of 25% serum by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553827	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of NaCl by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1765620	Antibiofilm activity against Klebsiella pneumoniae ATCC 700603 at 2 to 4 times MIC incubated for 24 hrs by crystal violet staining based assay	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553767	Antibacterial activity against Escherichia coli ATCC 25922 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707873	Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at 0.5 times MIC preincubated for 4 hrs followed by replating on MHB agar and measured after 24 hrs by time kill assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524075	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 12.5% serum albumin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674588	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella pullorum 7913	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553804	Bactericidal activity against Staphylococcus aureus ATCC 29213 assessed as reduction in bacterial growth at MBC by time-kill assay	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524065	Selectivity ratio of IC50 for pig IPECJ2 cells to geometric mean of the peptide MBC for bacteria	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID704813	Down regulation of COX2 expression in VEGFA-stimulated HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1516024	Antibacterial activity against Staphylococcus epidermidis ATCC 12228 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1905562	Antimicrobial activity against Bacillus subtilis ATCC 23857 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1524114	Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 at 2 uM up to 5000 secs by DiSC3-5 dye-based fluorescence spectrophotometric method	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765581	Hemolytic activity in BALB/C mouse erythrocytes incubated for 1 hr by absorbance method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553821	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of KCl	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524054	Hemolytic activity against human RBC after 1 hr	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1337937	Disruption of cytoplasmic membrane potential in methicillin-resistant Staphylococcus aureus JCSC 2172 at 10 ug/ml after 4 hrs by SYTOX green dye based fluorescence assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Structure-activity relationships and optimization of acyclic acylphloroglucinol analogues as novel antimicrobial agents.
AID704808	Inhibition of VEGFA-stimulated VEGF production in HUVEC at 5 to 20 uM after 24 hrs by enzyme immunoassay	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674647	Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL pepsin for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674623	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 4.5 mM K+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1691353	Hemolytic activity in sheep RBC measured after 2 hrs by ELISA	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1442116	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of NaCl by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1905213	Disruption of bacterial cell membrane in Escherichia coli ATCC 25922 at 5XMIC by SEM analysis	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Spermine-Conjugated Short Proline-Rich Lipopeptides as Broad-Spectrum Intracellular Targeting Antibacterial Agents.
AID1605796	Antibacterial activity against methicillin-resistance Staphylococcus aureus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1741130	Antifungal activity against yeast assessed as reduction in fungal growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID704802	Down regulation of VEGFA-stimulated VEGF-A expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis in presence of p38 inhibitor SB203580	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1433396	Induction of inner membrane permeabilisation in Escherichia coli ML-35 assessed as ONPG hydrolysis up to 30 ug/ml by beta-galactosidase enzyme coupled spectrophotometric analysis	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1516020	Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID710194	Antibacterial activity against Staphylococcus aureus ATCC 25923 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID357109	Antibacterial activity against cationic peptide-resistant Yersinia pestis KIM pYV- after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID710125	Antibacterial activity against Aeromonas caviae ATCC 15648 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1553826	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of NH4Cl	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID710198	Antibacterial activity against Enterococcus faecalis CIP 186 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1524033	Antimicrobial activity against Escherichia coli UB1005 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1869113	Antimicrobial activity against Pseudomonas aeruginosa KCTC 1637 assessed as minimal inhibitory concentration incubated for 18 hrs	2022	Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11	Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1553894	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Salmonella typhimurium ATCC 14028	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605806	Antibacterial activity against vancomycin-resistant Enterococcus faecalis 1002 assessed as log10 reduction in bacterial viability at 2 to 4 times MIC incubated for 30 mins in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time ki	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1524147	Stability of the compound assessed as Tritirachium album proteinase K-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1129357	Cytotoxicity against HUVEC after 1 hr by MTS/PMS assay	2014	Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7	Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1524037	Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674691	Stability of compound assessed as proteinase K (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369447	Antifungal activity against Candida albicans SP3876 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524044	Antimicrobial activity against Salmonella typhimurium C7731 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605811	Induction of pore formation in intact vancomycin-resistant Enterococcus faecalis 1002 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1765579	Antibacterial activity against Klebsiella pneumoniae ATCC 700603 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1674639	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 100% human serum by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369505	Binding affinity to phosphatidylcholine/phosphatidylethanolamine/phosphatidylinositol/ergosterol large unilamellar vesicle assessed as induction of calcein leakage at 2 to 32 uM after 15 mins by spectrofluorophotometric method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674629	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 50% human serum by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID357106	Antibacterial activity against Bordetella bronchiseptica CUN 11844-99 after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1369450	Antifungal activity against fluconazole-resistant Candida albicans 56214 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674622	Cytotoxicity against HEK-293T cells assessed as reduction in cell viability at lower concentration by MTT assay	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524085	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.5 mg/ml chymotrypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1516067	Antibacterial activity against Escherichia coli ATCC 25922 in presence of NaBH4 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID704821	Cytotoxicity against HUVEC assessed as cell viability at 5 uM after 48 hrs by MTT assay relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1433385	Antibacterial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 after 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1369461	Fungicidal activity against Candida albicans isolated from alveolar fluid after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707849	Hemolytic activity against mouse erythrocytes measured after 1 hr	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516026	Antibacterial activity against Acinetobacter baumannii AB1901 clinical isolate incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674612	Antibacterial activity against Enterococcus faecalis ATCC 29212 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1609355	Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1516075	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of FeCl3 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707914	Antibiofilm activity against ciprofloxacin-resistant Staphylococcus aureus ATCC 25923 at 0.5 to 8 uM after 24 hrs by crystal violet staining based assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1735121	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Escherichia coli O157:H7 CICC 21530	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674648	Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL proteinase K for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1661688	Antimicrobial activity against Candida albicans ATCC 10231 assessed as inhibition of microbial growth incubated for 48 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1741175	Induction of cell membrane permeability in Escherichia coli KCTC 1682 assessed as cytoplasmic membrane depolarization at 2 times MIC by ONPG dye based spectrophotometry	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516036	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus epidermidis ATCC 12228	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1719771	Hemolytic activity in human RBC assessed as hemolysis incubated for 1 hr by CO-ADD method
AID770111	Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition at 50 ug/ml after 18 to 20 hrs by broth microdilution method in presence of trypsin	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID69475	Minimum inhibitory concentration against Escherichia coli ATCC 25922	2004	Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5	Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1516021	Antibacterial activity against Salmonella enterica serovar typhimurium C77-31 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1605788	Antibacterial activity against Pseudomonas aeruginosa assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1553769	Antibacterial activity against Salmonella typhimurium ATCC 14028 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605797	Antibacterial activity against vancomycin-resistant Enterococcus assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1553817	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of ZnCl2	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1129355	Cytotoxicity against rat IEC-6 cells after 1 hr by MTS/PMS assay	2014	Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7	Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID583614	Toxicity in human RBC assessed as hemolysis upto 25 ug/ml	2010	Antimicrobial agents and chemotherapy, Sep, Volume: 54, Issue:9	New antiseptic peptides to protect against endotoxin-mediated shock.
AID1827113	Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 7.4 in presence of 50% serum	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID710127	Antibacterial activity against Klebsiella oxytoca CIP 7932 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1741110	Cytotoxicity against mouse NIH/3T3 cells assessed as reduction in cell viability at 20 uM incubated for 24 hrs by MTT assay	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1707876	Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at 2 times MIC preincubated for 2 hrs followed by replating on MHB agar and measured after 24 hrs by time kill assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1469691	Induction of membrane permeabilization in Escherichia coli ATCC 25922 assessed as loss of pili/flagella at MIC after 1 hr by atomic force microscopic method	2018	Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7	Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1741179	Induction of cell membrane permeability in Escherichia coli KCTC 1682 assessed as cytoplasmic membrane depolarization by measuring PI fluorescent signals at 2 times MIC measured after 1 hr by propidium iodide dye based flow cytometry analysis (Rvb = 9.8 %	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1735106	Antibacterial activity against Salmonella choleraesuis ATCC 13312 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID447945	Toxicity in human erythrocytes assessed as hemolytic activity at 5 ug/ml at pH 7.4 after 1 hr	2009	Bioorganic & medicinal chemistry letters, Oct-01, Volume: 19, Issue:19	Synthesis of antibacterial pseudopeptides with less hemolytic activity from a cytotoxic peptide and their pH-dependent activity.
AID1707881	Antimicrobial activity against Staphylococcus aureus ATCC 25923 at 0.5 times MIC after 15 passages by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524086	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.25 mg/ml chymotrypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1423350	Cytotoxicity against human MDA-MB-231 after 24 hrs by MTT assay	2018	Journal of natural products, 11-26, Volume: 81, Issue:11	Discovery and Characterization of Cyclotides from Rinorea Species.
AID1524132	Bactericidal activity against Salmonella typhimurium ATCC 14028 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1905563	Antimicrobial activity against Staphylococcus epidermidis ATCC 12228 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1701045	Induction of inner membrane permeability in Escherichia coli at 5 uM incubated for 1 hr by SYTOX Green-staining based flow cytometry analysis	2020	Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23	Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1553776	Antibacterial activity against Salmonella typhimurium C7731 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605798	Antibacterial activity against multidrug-resistant Acinetobacter baumannii assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID770113	Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1735114	Antibacterial activity against Bacillus cereus CMCC 63301 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID770123	Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1674688	Stability of compound assessed as trypsin (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553831	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of ZnCl by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369466	Fungicidal activity against Candida tropicalis cgmcc 2.1975 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524146	Stability of the compound assessed as pepsin (unknown origin)-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID710126	Antibacterial activity against Enterobacter aerogenes ATCC 13048 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1674607	Antibacterial activity against Salmonella typhimurium 14028 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1827098	Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1609431	Induction of membrane integrity disruption in Escherichia coli at 2 times of MIC by propidium iodide staining based flow cytometry relative to control (Rvb = 2.97 %)	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1735103	Antibacterial activity against Salmonella paratyphi B CICC 21495 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369478	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of KCl by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1916055	Antibacterial activity against methicillin-resistant Staphylococcus aureus N315 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID704806	Inhibition of VEGFA-stimulated JNK phosphorylation in HUVEC by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1616110	Inhibition of F1F0-ATP synthase in Escherichia coli relative to control	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	Recent advancements in mechanistic studies and structure activity relationship of F
AID1090767	Fungicidal activity against Penicillium digitatum PHI-26 conidia assessed as inhibition of conidia viability incubated for 16 hr by colony count assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1605842	Binding affinity to zwitterionic DOPC/cholesterol large unilamellar vesicles assessed as transformation of peptide secondary structure to alpha-helical conformation by CD spectropolarimetry	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1129353	Cytotoxicity against human Caco2 cells after 1 hr by MTS/PMS assay	2014	Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7	Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1905567	Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1707852	Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 29213	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1661690	Microbicidal activity against Bacillus subtilis ATCC 6633 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1765574	Antibacterial activity against Bacillus subtilis ATCC 23857 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1507591	Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3095 after 24 hrs	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1827086	Antibacterial activity against Salmonella typhimurium ATCC 14028 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1433374	Therapeutic index, ratio of MHC for sheep RBC to MIC for Pseudomonas aeruginosa KCTC 1637	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1827097	Antibacterial activity against Staphylococcus aureus ATCC 25923 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1524034	Antimicrobial activity against Escherichia coli 078 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1433383	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 after 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1527499	Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method	2020	European journal of medicinal chemistry, Jan-01, Volume: 185	Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1869120	Antimicrobial activity against Staphylococcus epidermidis KCTC 1917 assessed as minimal inhibitory concentration incubated for 18 hrs	2022	Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11	Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1524133	Bactericidal activity against Salmonella typhimurium C7731 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553859	Induction of membrane disruption in PC/CL large unilamellar vesicles assessed as calcein-entrapped liposome leakage at 1 uM after 15 mins by spectrofluorophotometric assay relative to control	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369452	Antifungal activity against fluconazole-resistant Candida albicans 17546 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1741127	Hemolytic activity in sheep RBC assessed as reduction in hemoglobin incubated for 1 hr	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1553764	Hemolytic activity in human RBC at 128 uM measured after 1 hr relative to control	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1756133	Hemolytic activity against human RBC assessed as concentration required to cause 50% hemolysis measured after 1 hr
AID1707882	Antimicrobial activity against Staphylococcus epidermidis ATCC 12228 at 0.5 times MIC after 15 passages by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553900	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Salmonella typhimurium C7731	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369485	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of 25% human heat-inactivated serum by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524127	Bactericidal activity against Pseudomonas aeruginosa PAO1 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553866	Induction of outer membrane permeabilization in Escherichia coli ATCC 25922 at 1 to 64 uM by NPN-dye based assay	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516081	Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 12 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553765	Cytotoxicity against mouse RAW264.7 cells assessed as cell viability at 2 to 64 uM measured after 18 to 24 hrs by MTT assay relative to control	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553816	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of MgCl2	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1442090	Antibacterial activity against ciprofloxacin-resistant Pseudomonas aeruginosa 11411 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1433395	Induction of outer membrane permeabilization in Escherichia coli KCTC 1682 assessed as NPN uptake by spectrofluorophotometric analysis	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1516034	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 29213	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674616	Hemolytic activity in human RBC assessed as hemolysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735119	Antifungal activity against Candida albicans ATCC 10231 assessed as fungal growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1827104	Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 6.5 in presence of NaCl	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1661695	Microbicidal activity against Candida albicans ATCC 10231 assessed as inhibition of colony growth incubated for 48 hrs followed by replating and further incubated for 48 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1765590	Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for bacteria	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1507589	Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3089 after 24 hrs	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1691356	Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Bacillus subtilis KCTC 3068	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1090763	Toxicity in Homo sapiens (human) RBCs assessed as hemolytic activity	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1741131	Therapeutic index, ratio of HC10 for sheep RBC to geometric mean MIC for gram positive bacteria	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID704819	Cytotoxicity against HUVEC assessed as cell viability at 20 uM after 48 hrs by MTT assay relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1735101	Antibacterial activity against Escherichia coli ATCC 35150 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1433373	Therapeutic index, ratio of MHC for sheep RBC to MIC for Escherichia coli KCTC 1682	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1609354	Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID357111	Antibacterial activity against Brucella abortus 9.19 (per-) after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID770120	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1527502	Antimicrobial activity against multi drug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method	2020	European journal of medicinal chemistry, Jan-01, Volume: 185	Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1553787	Bactericidal activity against Salmonella pullorum ATCC 7913 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1741112	Cytotoxicity against mouse NIH/3T3 cells assessed as reduction in cell viability at 1.25 to 80 uM incubated for 24 hrs by MTT assay	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674614	Antibacterial activity against Streptococcus agalactiae H92 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID654510	Antiproliferative activity against activated human PBMC assessed as decrease in cell division at 1.6 uM after 72 hrs by flow cytometric analysis	2012	Journal of natural products, Feb-24, Volume: 75, Issue:2	Do plant cyclotides have potential as immunosuppressant peptides?
AID1735152	Induction of cell membrane depolarization in Escherichia coli O157:H7 CICC 21530 assessed as increase in fluorescence intensity at 0.5 to 2 times MIC preincubated for 90 mins followed by KCl addition and measured after 15 to 30 mins by DiSC3-5 staining ba	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674689	Stability of compound assessed as chymotrypsin (unknown origin)-mediated drug degradation after 1 hr by SDS-PAGE analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID704810	Down regulation of COX2 expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1553785	Bactericidal activity against Escherichia coli UB1005 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674640	Stability of compound at 100 degreeC after 30 to 90 mins	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1516030	Haemolytic activity in human erythrocytes assessed as lowest concentration causing 5% hemolysis after 1 hr	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369484	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of 12.5% human heat-inactivated serum by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1827101	Ratio of MHC for hemolytic activity against human RBC assessed as hemoglobin release at pH 6.5 to MHC for hemolytic activity against human RBC assessed as hemoglobin release at pH 7.4	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1516023	Antibacterial activity against Escherichia coli ATCC 25922 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516064	Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 10 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524124	Bactericidal activity against Escherichia coli K88 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369445	Antifungal activity against Candida albicans SP3903 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765578	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1516069	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of NaCl by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524135	Bactericidal activity against Acinetobacter baumannii incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID577469	Antimicrobial activity against Escherichia coli	2010	Antimicrobial agents and chemotherapy, Oct, Volume: 54, Issue:10	Cationic amphiphiles, a new generation of antimicrobials inspired by the natural antimicrobial peptide scaffold.
AID1553803	Bactericidal activity against Escherichia coli ATCC 25922 assessed as reduction in bacterial growth at MBC by time-kill assay	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553897	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli K88	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1741122	Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674637	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 25% human serum by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735122	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 25922	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524040	Antimicrobial activity against Pseudomonas aeruginosa 26305 clinical isolates after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553904	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Staphylococcus aureus ATCC 29213	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707846	Antimicrobial activity against Bacillus subtilis ATCC 23857 after 18 hrs by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369457	Fungicidal activity against Candida albicans SP3931 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524079	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.5 mg/ml trypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1827111	Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 7.4 in presence of NaCl	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1674609	Antibacterial activity against Salmonella pullorum 7913 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1735118	Antibacterial activity against methicillin resistant Staphylococcus aureus ATCC 43300 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1507592	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 after 24 hrs	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID704811	Down regulation of VEGF-A expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1735135	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Listeria monocytogenes CICC 21633	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1337921	Antibacterial activity against methicillin-resistant Staphylococcus aureus JCSC 2172 after 8 to 12 hrs by resazurin dye based microdilution method	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Structure-activity relationships and optimization of acyclic acylphloroglucinol analogues as novel antimicrobial agents.
AID1524111	Induction of outer membrane permeabilization in Escherichia coli ATCC 25922 at 1 uM by NPN-dye based assay relative to control	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1457539	Cytotoxicity against mouse J774A.1 cells assessed as damage to cell membrane by measuring propidium iodide intake at 5 uM by spectrofluorometric analysis	2017	Journal of medicinal chemistry, 07-27, Volume: 60, Issue:14	Lipophosphonoxins II: Design, Synthesis, and Properties of Novel Broad Spectrum Antibacterial Agents.
AID1369432	Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 4330 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1605810	Induction of pore formation in intact vancomycin-resistant Enterococcus faecalis ATCC 29212 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1369428	Antibacterial activity against Escherichia coli 1005 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674589	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella typhimurium 7731	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524041	Antimicrobial activity against Pseudomonas aeruginosa CICC 21625 clinical isolates after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605799	Antibacterial activity against Carbapenem-Resistant Enterobacteriaceae assessed as reduction in bacterial growth incubated for 24 hrs by broth microdilution method	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1735136	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Bacillus cereus CMCC 63301	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID357105	Antibacterial activity against Acinetobacter baumannii ATCC 19606 after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1765591	Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for fungi	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1691362	Antimicrobial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1553800	Hemolytic activity in human RBC measured after 1 hr	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524130	Bactericidal activity against Pseudomonas aeruginosa CICC 21625 clinical isolates incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707868	Ratio of MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in presence of 2.5% serum to MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in absence of serum	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID704827	Antiangiogenic activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as reduction of vessel formation at 0.5 mg/kg, sc qd for 7 days relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1516061	Antibacterial activity against Escherichia coli ATCC 25922 in presence of 50% serum by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741125	Antifungal activity against Candida albicans KCTC 7965 assessed as reduction in fungal growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674587	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus 11011	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553778	Antibacterial activity against Staphylococcus aureus ATCC 25923 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1569924	Antibacterial activity against Chlamydia trachomatis D/UW-3/Cx infected in mouse McCoy cells assessed as reduction in infected cells preincubated for 2 hrs and measured after 48 hrs by immunofluorescence method	2019	European journal of medicinal chemistry, Oct-15, Volume: 180	Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID704812	Down regulation of VEGFR2 expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1524035	Antimicrobial activity against Escherichia coli K88 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1735099	Antibacterial activity against Escherichia coli O157:H7 CICC 21530 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID704809	Inhibition of VEGFA-stimulated PGE2 production in HUVEC at 5 to 20 uM after 24 hrs by ELISA	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1609341	Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID770125	Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1765616	Induction of inner membrane permeabilization in Klebsiella pneumoniae ATCC 700603using ONPG as substrate by spectroscopic method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1442120	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of MgCl2 by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1553898	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli K99	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553822	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of CaCl2	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707913	Antibiofilm activity against Staphylococcus aureus ATCC 25923 at 0.5 to 8 uM after 24 hrs by crystal violet staining based assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524069	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of ZnCl2	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1516022	Antibacterial activity against Escherichia coli UB1005 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516062	Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524080	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.25 mg/ml trypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1827091	Antibacterial activity against Staphylococcus aureus ATCC 25923 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1524076	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 4 mg/ml trypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369430	Antibacterial activity against Salmonella pullorum ATCC 7913 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765573	Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1735102	Antibacterial activity against Salmonella paratyphi A CICC 20501 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524077	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 2 mg/ml trypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765592	Antibacterial activity against Gram-positive bacteria incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1741124	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1090771	Antimicrobial activity against Saccharomyces cerevisiae FY1679 assessed as microbial growth inhibition after 4 days by microtiter plate assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID125770	Minimum inhibitory concentration against Micrococcus luteus ATCC 9341	2004	Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5	Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1553796	Bactericidal activity against Staphylococcus aureus ATCC 29213 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1707861	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of ZnCl2 by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID70092	Compound was evaluated for antibacterial activity against Escherichia coli	1996	Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16	De novo antimicrobial peptides with low mammalian cell toxicity.
AID1916057	Antibacterial activity against Escherichia coli ATCC 25922 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1369455	Antifungal activity against Candida parapsilosis cgmcc 2.3989 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553808	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 assessed as ratio of MBC after and before 30 serial passages at sub-MBC	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827103	Cytotoxicity against mouse RAW264.7 cells assessed as inhibition of cell growth at pH 6.5 measured after 24 hrs by MTT assay	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1735125	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella paratyphi B CICC 21495	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1905561	Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1553857	Induction of membrane disruption in PG/CL/PE large unilamellar vesicles assessed as calcein-entrapped liposome leakage at 1 to 64 uM after 15 mins by spectrofluorophotometric assay	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1609340	Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1661693	Microbicidal activity against Escherichia coli ATCC 8739 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1369439	Bactericidal activity against Staphylococcus aureus ATCC 29213	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524046	Antimicrobial activity against Acinetobacter baumannii after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524055	Cytotoxicity against mouse RAW264.7 cells assessed as cell death after 18 to 24 hrs by MTT assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID770121	Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1916063	Antibacterial activity against Klebsiella pneumoniae ATCC 14581 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1524153	Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 assessed as induction cytoplasmic ONPG release at 2 to 16 uM up to 120 mins by DiSC3-5 dye-based fluorescence spectrophotometric method	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1691354	Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Escherichia coli KCTC 1682	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1369462	Fungicidal activity against fluconazole-resistant Candida albicans 56452 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID710197	Antibacterial activity against Streptococcus equinus ATCC 5623 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1412406	Induction of membrane disruption in methicillin-sensitive Staphylococcus aureus FDA 209P assessed as increase in K+ efflux at 10 uM after 30 mins relative to control	2018	MedChemComm, Mar-01, Volume: 9, Issue:3	Membrane-active antimicrobial poly(amino-modified alkyl) β-cyclodextrins synthesized
AID1674683	Stability of compound assessed as proteinase K (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1433377	Therapeutic index, ratio of MHC for sheep RBC to MIC for Staphylococcus aureus KCTC 1621	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1674626	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 6 uM NH4+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1691355	Therapeutic index, ratio of MHC for sheep RBC to geometric mean of peptide MIC for Pseudomonas aeruginosa KCTC 1637	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1735120	Hemolytic activity against human red blood cells assessed as concentration required to cause 10% hemoglobin release measured after 1 hr by microplate reader analysis	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1707875	Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at 4 times MIC preincubated for 30 mins followed by replating on MHB agar and measured after 24 hrs by time kill assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1905564	Antimicrobial activity against Enterococcus faecalis ATCC 29212 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID425040	Toxicity against human erythrocytes in assay tube containing mixture of erythrocytes/Listeria monocytogenes cells at 40 ug/ml after 30 mins	2007	Antimicrobial agents and chemotherapy, Nov, Volume: 51, Issue:11	Antimicrobial effect of halocidin-derived peptide in a mouse model of Listeria infection.
AID1516035	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 25923	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1701046	Induction of outer membrane re-arragenemnts in Escherichia coli ATCC 25922 incubated for 4 mins by NPN uptake assay	2020	Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23	Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1887599	Bactericidal activity against Staphylococcus aureus ATCC 29213 assessed as increase in extracellular ATP level at 2.5 times MIC after 1 hr by ATP bioluminescence assay	2022	Journal of natural products, 10-28, Volume: 85, Issue:10	Developing the Natural Prenylflavone Artocarpin from
AID1553784	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827084	Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1707843	Antimicrobial activity against Staphylococcus epidermidis ATCC 12228 after 18 hrs by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553805	Fungicidal activity against Candida albicans cgmcc2.2086 assessed as reduction in bacterial growth at MFC by time-kill assay	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1609429	Induction of cytoplasmic membrane depolarization in Staphylococcus aureus at 2 times of MIC for a period of 600 sec by DiSC3-5-fluorescence based assay	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1442117	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of KCl by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1369481	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of CaCl2 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524072	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of MgCl2	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1905566	Antimicrobial activity against Escherichia coli ATCC 25922 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID357101	Cytotoxicity against human HeLa cells at 100 ug/ml after 24 hrs by neutral red uptake assay relative to control	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1553779	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1304016	Toxicity in human RBC assessed as hemolytic activity at 2 uM measured after 1 hr by spectrophotometric analysis	2016	Bioorganic & medicinal chemistry, 07-01, Volume: 24, Issue:13	Stable and biocompatible cystine knot peptides from the marine sponge Asteropus sp.
AID1369483	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of FeCl3 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1129354	Cytotoxicity against human HepG2 cells after 1 hr by MTS/PMS assay	2014	Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7	Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1827100	Hemolytic activity against human RBC assessed as hemoglobin release at pH 6.5 incubated for 1 hrs	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1741115	Antibacterial activity against Bacillus subtilis KCTC 3068 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516063	Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 4 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741133	Therapeutic index, ratio of HC10 for sheep RBC to geometric mean MIC for yeast	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1891823	Hemolytic activity in human RBC assessed as hemolysis incubated for 1 hr by Neubauer hemocytometer analysis	2022	Bioorganic & medicinal chemistry, 06-15, Volume: 64	Valorisation of the diterpene podocarpic acid - Antibiotic and antibiotic enhancing activities of polyamine conjugates.
AID1507614	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by disC3-5 dye based fluorescence assay	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID710196	Antibacterial activity against Micrococcus luteus ATCC 10240 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1516065	Antibacterial activity against Escherichia coli ATCC 25922 incubated for 2 hrs in presence of sodium phosphate buffer at pH 12 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1442088	Antibacterial activity against Pseudomonas aeruginosa CICC 21625 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID710129	Antibacterial activity against Salmonella enterica ATCC 13076 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1516059	Antibacterial activity against Escherichia coli ATCC 25922 in presence of 12.5% serum by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553775	Antibacterial activity against Escherichia coli 078 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735107	Antibacterial activity against Salmonella typhimurium CMCC 51005 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1516029	Antibacterial activity against Staphylococcus aureus 11011 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516080	Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 10 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1527503	Antimicrobial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method	2020	European journal of medicinal chemistry, Jan-01, Volume: 185	Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1735142	Cytotoxicity against mouse RAW264.7 cells assessed as increase in cell viability at 64 uM incubated for 24 hrs by MTT assay relative to control	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674592	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella typhimurium 14028	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1741132	Therapeutic index, ratio of HC10 for sheep RBC to geometric mean MIC for gram negative bacteria	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1661685	Antimicrobial activity against Enterococcus faecalis ATCC 29121 assessed as inhibition of microbial growth incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1609359	Antibacterial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605813	Induction of pore formation in intact Escherichia coli 1004 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1674680	Stability of compound assessed as trypsin (unknown origin)-mediated drug degradation after 1 hr by RP-HPLC analysis	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674633	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 1 mM Mg2+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1887600	Bactericidal activity against Staphylococcus aureus ATCC 29213 assessed as decrease in intracellular ATP level at 2.5 times MIC after 1 hr by ATP bioluminescence assay	2022	Journal of natural products, 10-28, Volume: 85, Issue:10	Developing the Natural Prenylflavone Artocarpin from
AID1516019	Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707930	Induction of membrane disruption in Staphylococcus aureus ATCC 25923 assessed as PI-positive cells at 4 times MIC measured after 2 hrs by propidium iodide staining based flow cytometry relative to control	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1735130	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella enteritidis CICC 21527	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524067	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of KCl	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1707867	Ratio of MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in presence of 10% serum to MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in absence of serum	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1524045	Antimicrobial activity against Salmonella pullorum C7913 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1507593	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 after 24 hrs	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1916062	Antibacterial activity against Klebsiella pneumoniae ATCC 10031 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1369441	Bactericidal activity against Staphylococcus epidermidis ATCC 12228	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704805	Increase of VEGFA-stimulated p38 phosphorylation in HUVEC by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1741120	Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516071	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of NH4Cl by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516054	Antibacterial activity against Escherichia coli ATCC 25922 in presence of NH4Cl by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524126	Bactericidal activity against Pseudomonas aeruginosa ATCC 27853 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524056	Cytotoxicity against HEK293T cells assessed as cell death after 18 to 24 hrs by MTT assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765622	Antibacterial activity against Staphylococcus aureus ATCC 25923 at 0.5 to 1 times MIC incubated for 24 hrs by crystal violet staining based assay	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID458038	Toxicity in human RBCs assessed as induction of hemolysis at 20 uM relative to untreated control	2010	Bioorganic & medicinal chemistry, Mar-01, Volume: 18, Issue:5	Design, synthesis and antimicrobial properties of non-hemolytic cationic alpha-cyclopeptoids.
AID1516033	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella enterica serovar typhimurium C77-31	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1369476	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of FeCl3 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1433369	Antimicrobial activity against Escherichia coli KCTC 1682 incubated for 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1765619	Antibiofilm activity against Escherichia coli ATCC 25922 at 4 times MIC incubated for 24 hrs by crystal violet staining based assay	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1553907	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Candida tropicalis cgmcc2.1975	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID710128	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID309576	Cytotoxicity against human erythrocytes assessed as hemolysis at 25 ug/ml	2007	Bioorganic & medicinal chemistry letters, Nov-01, Volume: 17, Issue:21	Design and synthesis of novel antibacterial peptide-resin conjugates.
AID1516032	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli UB1005	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707858	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of NH4Cl by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID656071	Induction of membrane depolarization in Aspergillus fumigatus at 1.56 to 100 uM at pH 5.5 by DiSC3(5)-based fluorescence assay	2012	Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3	Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1442094	Antibacterial activity against Pseudomonas aeruginosa 25349 clinical isolate after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1674604	Antibacterial activity against Staphylococcus aureus 11011 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1442095	Antibacterial activity against Pseudomonas aeruginosa 26305 clinical isolate after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1442107	Binding affinity to Pseudomonas aeruginosa ATCC 27853 LPS by SPR spectroscopic analysis	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1415096	Induction of membrane permeabilization in Escherichia coli KCTC 1682 assessed as PI-positive cells at 4 uM after 1 to 2 hrs by propidium iodide-staining based flow cytometry (Rvb = 2.36%)	2018	Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24	Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1369451	Antifungal activity against Candida albicans 14936 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1661686	Antimicrobial activity against Escherichia coli ATCC 8739 assessed as inhibition of microbial growth incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1090768	Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression progression at 32 uM measured 7 days post fungal inoculation by orange fruit decay assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1553799	Fungicidal activity against Candida tropicalis cgmcc2.1975 incubated for 48 hrs followed by replating on YM agar plate and measured after 48 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827096	Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1524032	Antimicrobial activity against Escherichia coli ATCC 25922 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1741116	Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674591	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli UB1005	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1369460	Fungicidal activity against Candida albicans SP3876 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1609358	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID770114	Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1090765	Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression progression at 4 uM pre-incubated with fungus for 16 hr measured 7 days post fungal inoculation by orange fruit decay assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID770116	Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1553818	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of FeCl3	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516093	Induction of cytoplasmic membrane depolarization in Escherichia coli UB1005 at 2 uM by DiSC3-5 dye based fluorescence method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID577693	Induction of outer membrane permeabilization of Escherichia coli ML-35p by nitrocefin permeation based spectrophotometric assay	2010	Antimicrobial agents and chemotherapy, Sep, Volume: 54, Issue:9	Depolarization, bacterial membrane composition, and the antimicrobial action of ceragenins.
AID1516078	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of 50% serum by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516079	Antibacterial activity against Staphylococcus aureus ATCC 29213 incubated for 2 hrs in presence of sodium phosphate buffer at pH 4 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674638	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 50% human serum by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1741121	Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1674586	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Staphylococcus aureus ATCC 29213	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID357104	Antibacterial activity against Escherichia coli ATCC 25922 after 24 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID704804	Increase of VEGFA-stimulated p38 phosphorylation in HUVEC by Western blot analysis in presence of p38 inhibitor SB203580	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID770112	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1869119	Antimicrobial activity against Staphylococcus aureus KCTC 1621 assessed as minimal inhibitory concentration incubated for 18 hrs	2022	Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11	Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1539024	Antibacterial activity against methicillin-resistant Staphylococcus aureus JCSC 4744 incubated overnight by CLSI protocol based microdilution assay	2019	Journal of natural products, 07-26, Volume: 82, Issue:7	Callistemonols A and B, Potent Antimicrobial Acylphloroglucinol Derivatives with Unusual Carbon Skeletons from
AID1516057	Antibacterial activity against Escherichia coli ATCC 25922 in presence of CaCl2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1412405	Induction of membrane disruption in methicillin-sensitive Staphylococcus aureus FDA 209P assessed as increase in K+ efflux after 30 mins	2018	MedChemComm, Mar-01, Volume: 9, Issue:3	Membrane-active antimicrobial poly(amino-modified alkyl) β-cyclodextrins synthesized
AID1735133	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Staphylococcus aureus GIM 1.160	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1442089	Antibacterial activity against Pseudomonas aeruginosa CICC 21630 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1542766	Hemolytic activity against human RBC incubated for 10 mins under shaking condition measured after 1 hr	2019	Bioorganic & medicinal chemistry, 05-15, Volume: 27, Issue:10	6-Bromoindolglyoxylamido derivatives as antimicrobial agents and antibiotic enhancers.
AID1516082	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of H202 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1553815	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of CaCl2	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1605808	Antibacterial activity against Escherichia coli 1004 assessed as reduction in bacterial viability at 2 or 4 times MIC incubated up to 24 hrs in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time kill kinetics assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1905565	Antimicrobial activity against Klebsiella pneumoniae ATCC 700603 assessed as reduction of bacterial growth incubated for 18 hrs by CLSI protocol based broth microdilution method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Novel β-Hairpin Antimicrobial Peptides Containing the β-Turn Sequence of -RRRF- Having High Cell Selectivity and Low Incidence of Drug Resistance.
AID1605794	Induction of pore formation in zwitterionic DOPC/cholesterol large unilamellar vesicles assessed as calcein release at 0.39 to 50 uM measured for 60 mins by fluorescence based assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID704814	Down regulation of VEGF-A expression in VEGFA-stimulated HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1827094	Antibacterial activity against Escherichia coli ATCC 25922 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1741123	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1735112	Antibacterial activity against Listeria monocytogenes CICC 21662 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID656072	Induction of membrane depolarization in Aspergillus fumigatus at 1.56 to 100 uM at pH 7.5 by DiSC3(5)-based fluorescence assay	2012	Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3	Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1524078	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 1 mg/ml trypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553860	Displacement of BODIPY-TR-cadaverine from Escherichia coli O111:B4 LPS after 1 hr by spectrofluorophotometric method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1442092	Antibacterial activity against ceftazidime-resistant Pseudomonas aeruginosa 11431 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1553790	Bactericidal activity against Escherichia coli K99 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553783	Antifungal activity against Candida tropicalis cgmcc2.1975 measured after 48 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1674605	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674611	Antibacterial activity against Staphylococcus epidermidis ATCC 12228 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID48746	Minimum inhibitory concentration against Candida albicans ATCC 36232	2004	Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5	Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1707844	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369443	Antifungal activity against Candida albicans cgmcc 2.2086 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1433412	Antimicrobial activity against Escherichia coli KCTC 1682 using 4 hrs trypsin incubated compound measured after overnight incubation by radial diffusion assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1524064	Selectivity ratio of IC50 for HEK293T cells to geometric mean of the peptide MBC for bacteria	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605825	Stability of the compound in rabbit tear fluids assessed as parent compound remaining measured after 4 hrs by UPLC-MS analysis	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1674582	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Streptococcus agalactiae H92	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553819	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of NH4Cl	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1691344	Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1707925	Binding affinity to LPS (unknown origin) assessed as bacterial killing at 2 times MIC preincubated for 1 hr followed by Staphylococcus aureus ATCC 25923 addition and measured after 2 hrs by colony counting method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1609343	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1605803	Hemolytic activity against human erythrocytes assessed as hemoglobin release incubated for 1 hr	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID577468	Antimicrobial activity against Staphylococcus aureus	2010	Antimicrobial agents and chemotherapy, Oct, Volume: 54, Issue:10	Cationic amphiphiles, a new generation of antimicrobials inspired by the natural antimicrobial peptide scaffold.
AID1674645	Antibacterial activity against Staphylococcus aureus 29213 with 0.0625-2 mg/mL trypsin for 1 hr followed by test compound addition measured after 4 to 8 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID770119	Hemolytic activity in human RBC assessed as hemoglobin release after 1 hr	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1735151	Induction of inner membrane permeabilization in Escherichia coli O157:H7 CICC 21530 assessed as cytoplasmic beta-galactosidase release at 1 times MIC using ONPG as substrate by fluorescence assay	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1553861	Displacement of BODIPY-TR-cadaverine from Escherichia coli O111:B4 LPS at 1 to 64 uM after 1 hr by spectrofluorophotometric method relative to control	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827087	Antibacterial activity against Escherichia coli ATCC 25922 assessed as inhibition of bacterial growth at pH 7.4 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1412407	Antibacterial activity against Staphylococcus aureus FDA 209P assessed as decrease in cell viability after 30 mins by colony counting method	2018	MedChemComm, Mar-01, Volume: 9, Issue:3	Membrane-active antimicrobial poly(amino-modified alkyl) β-cyclodextrins synthesized
AID1063813	Antibacterial activity against Escherichia coli ATCC 25922 assessed as release of beta-galactosidase after 1 hr relative to control	2014	Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2	Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1507594	Antibacterial activity against Vancomycin-resistant Enterococcus faecium ATCC 51559 after 24 hrs	2017	European journal of medicinal chemistry, Aug-18, Volume: 136	LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity.
AID1433371	Antimicrobial activity against Staphylococcus epidermidis KCTC 1917 incubated for 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID656070	Induction of membrane damage in Aspergillus fumigatus at 1.56 to 100 uM at pH 7.5 by Sytox green-based fluorescence assay	2012	Journal of medicinal chemistry, Feb-09, Volume: 55, Issue:3	Trivalent ultrashort lipopeptides are potent pH dependent antifungal agents.
AID1827110	Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 6.5 in presence of 50% serum	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1609356	Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1369487	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of 12.5% human heat-inactivated serum by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369456	Fungicidal activity against Candida albicans cgmcc 2.2086 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1735141	Hemolytic activity against human red blood cells assessed as hemoglobin release at 64 uM measured after 1 hr by microplate reader analysis relative to control	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1516031	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 25922	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1661694	Microbicidal activity against Pseudomonas aeruginosa ATCC 9027 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1735126	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella paratyphi C CICC 21512	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674585	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Enterococcus faecalis ATCC 29212	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1674606	Antibacterial activity against Escherichia coli UB1005 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553829	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of CaCl by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID762049	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition at 50 ug/ml preincubated with trypsin for 1 hr followed by 18 to 20 hrs incubation in bacterial culture by broth microdilution method	2013	Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16	Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID704818	Cytotoxicity against HUVEC assessed as cell viability at 40 uM after 48 hrs by MTT assay relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369482	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of ZnCl2 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524081	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 0.125 mg/ml trypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1527494	Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method	2020	European journal of medicinal chemistry, Jan-01, Volume: 185	Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1423348	Cytotoxicity against human HFF1 after 24 hrs by MTT assay	2018	Journal of natural products, 11-26, Volume: 81, Issue:11	Discovery and Characterization of Cyclotides from Rinorea Species.
AID1369488	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of 25% human heat-inactivated serum by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID704820	Cytotoxicity against HUVEC assessed as cell viability at 10 uM after 48 hrs by MTT assay relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1674621	Cytotoxicity against mouse RAW264.7 cells assessed as reduction in cell viability lower concentration by MTT assay	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553868	Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 assessed as fluorescence intensity at 2 uM up to 3000 secs by DiSC3-5 dye-based fluorescence spectrophotometric method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1090773	Antimicrobial activity against Penicillium digitatum PHI-26 assessed as microbial growth inhibition after 4 days by microtiter plate assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID704835	Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as tumor growth inhibition at 0.5 mg/kg, sc qd for 18 days relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID770117	Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1605793	Induction of pore formation in negatively charged DOPE/DOPG large unilamellar vesicles assessed as calcein release at 0.39 to 50 uM measured for 60 mins by fluorescence based assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID704833	Antitumor activity against VEGFA-stimulated mouse highly metastatic LLC cells xenografted in C57BL/6 mouse assessed as tumor growth inhibition at 5 mg/kg, sc qd for 18 days relative to control	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1553771	Antibacterial activity against Salmonella pullorum ATCC 7913 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516070	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of KCl by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1735139	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Pseudomonas fluorescens CICC 21620	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1369472	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of NH4Cl by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1369448	Antifungal activity against Candida albicans isolated from alveolar fluid after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553832	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of FeCl by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369480	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of MgCl2 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID710120	Half life in bovine serum	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1707847	Antimicrobial activity against methicillin-resistant Staphylococcus aureus 75 after 18 hrs by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1527501	Antimicrobial activity against multi drug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method	2020	European journal of medicinal chemistry, Jan-01, Volume: 185	Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1707945	Cytotoxicity against HEK293T cells assessed as reduction in cell viability at 1 uM measured after 24 hrs by MTT assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553788	Bactericidal activity against Pseudomonas aeruginosa ATCC 27853 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1433380	Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3089 after 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1765588	Antibacterial activity against bacteria incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1765576	Antibacterial activity against Staphylococcus epidermidis ATCC 12228 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID164409	Compound was evaluated for antibacterial activity against Pseudomonas aeruginosa	1996	Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16	De novo antimicrobial peptides with low mammalian cell toxicity.
AID1369477	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of NaCl by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553770	Antibacterial activity against methicillin-resistant Staphylococcus aureus ATCC 43300 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1369449	Antifungal activity against fluconazole-resistant Candida albicans 56452 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1735104	Antibacterial activity against Salmonella paratyphi C CICC 21512 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1707942	Induction of nucleic acid leakage in Staphylococcus aureus ATCC 25923 at 4 times MIC	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1674641	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of trypsin by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553830	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs in presence of MgCl by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID207641	Compound was evaluated for antibacterial activity against Staphylococcus aureus	1996	Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16	De novo antimicrobial peptides with low mammalian cell toxicity.
AID1674590	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for Salmonella choleraesuis 503	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1707863	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of 2.5% serum by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1433370	Antimicrobial activity against Pseudomonas aeruginosa KCTC 1637 incubated for 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1609339	Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1433382	Antibacterial activity against methicillin resistant Staphylococcus aureus CCARM 3095 after 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1415095	Induction of membrane permeabilization in Staphylococcus aureus KCTC 1621 at 2 times MIC concentration up to 300 secs by SYTOX green uptake assay	2018	Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24	Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1661683	Antimicrobial activity against Bacillus subtilis ATCC 6633 assessed as inhibition of microbial growth incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1553786	Bactericidal activity against Salmonella typhimurium ATCC 14028 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID205530	Minimum inhibitory concentration against Staphylococcus aureus ATCC 6538	2004	Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5	Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID770110	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition at 50 ug/ml after 18 to 20 hrs by broth microdilution method in presence of trypsin	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1553823	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of MgCl2	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735140	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for methicillin resistant Staphylococcus aureus ATCC 43300	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1741173	Induction of cell membrane permeability in Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by DiSC3-5 dye based spectrofluorometry	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516028	Antibacterial activity against Pseudomonas aeruginosa 25349 clinical isolate incubated for 18 to 24 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1741117	Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1516073	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of ZnCl2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674634	Antibacterial activity against Staphylococcus aureus ATCC 29213 after 18 to 24 hrs in presence of 8 uM Zn2+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553772	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1553825	Antibacterial activity against Staphylococcus aureus ATCC 29213 measured after 18 to 24 hrs in presence of FeCl3	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1869112	Antimicrobial activity against Escherichia coli KCTC 1682 assessed as minimal inhibitory concentration incubated for 18 hrs	2022	Journal of medicinal chemistry, 06-09, Volume: 65, Issue:11	Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors.
AID1516090	Induction of outer membrane permeabilization in Escherichia coli UB1005 assessed as increase in NPN uptake at 0.5 to 4 uM by spectrofluorophotometric assay	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1674613	Antibacterial activity against methicillin-resistant Staphylococcus aureus 43300 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1765595	Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for gram-negative bacteria	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1905243	Disruption of bacterial cell membrane in Escherichia coli ATCC 25922 assessed as proportion of bacteria with damaged cell membrane at 5X MIC incubated for 1 hr by PI staining based flow cytometric analysis (Rvb = 0.7%)	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	Spermine-Conjugated Short Proline-Rich Lipopeptides as Broad-Spectrum Intracellular Targeting Antibacterial Agents.
AID1553793	Bactericidal activity against methicillin-resistant Staphylococcus aureus ATCC 43300 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524039	Antimicrobial activity against Pseudomonas aeruginosa CICC 21630 clinical isolates after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID704807	Inhibition of VEGFA-stimulated ERK1/2 phosphorylation in HUVEC by Western blot analysis	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1090769	Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression at 32 uM pre-incubated with fungal conidia for 16 hr by orange fruit decay assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1609342	Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method	2019	European journal of medicinal chemistry, Nov-15, Volume: 182	The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1765611	Antibacterial activity against Klebsiella pneumoniae ATCC 700603 incubated with 0.02 ug/ml chymotrypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1369429	Antibacterial activity against Salmonella typhimurium ATCC 14028 after 24 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674627	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 6 uM Fe3+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1553768	Antibacterial activity against Escherichia coli UB1005 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID704825	Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as hair loss at 0.5 to 5 mg/kg, sc qd for 7 days	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1369534	Fungicidal activity against Candida albicans 58288 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID770115	Antibacterial activity against Salmonella typhimurium KCTC 1926 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method in presence of NaCl	2013	European journal of medicinal chemistry, Oct, Volume: 68	Discovery of novel histidine-derived lipo-amino acids: applied in the synthesis of ultra-short antimicrobial peptidomimetics having potent antimicrobial activity, salt resistance and protease stability.
AID1369508	Disruption of cytoplasmic membrane electrical potential in Escherichia coli ATCC 25922 at MBC after 800 secs by DiSC3-5 dye-based fluorescence spectrophotometric method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1090770	Antimicrobial activity against Escherichia coli DH5[alpha] assessed as microbial growth inhibition after 4 days by microtiter plate assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1741128	Antibacterial activity against Gram positive bacteria assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1765582	Cytotoxicity against human glomerular mesangial cells incubated for 12 hrs by MTT assay	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1674608	Antibacterial activity against Salmonella typhimurium 7731 after 18 to 24 hrs by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524057	Cytotoxicity against IPECJ2 cells assessed as cell death after 18 to 24 hrs by MTT assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605835	Cytotoxicity against HDF cells assessed as reduction in metabolic activity at 16 ug/ml incubated for 24 hrs by MTS assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1691346	Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1735123	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Escherichia coli ATCC 35150	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1827095	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 assessed as inhibition of bacterial growth at pH 6.5 incubated for 24 hrs by NCCLS protocol based method	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1691343	Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 18 to 22 hrs by spectrophotometry based broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1090772	Antimicrobial activity against Penicillium digitatum PHI-26 assessed as inhibition of orange postharvest decay progression at 32 uM by orange fruit decay assay	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1735116	Antibacterial activity against Bacillus pumilus CMCC 63202 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1201457	Induction of hemolysis in mouse erythrocytes at 12.5 and 25 ug/ml incubated at 37 degC for 15 mins	2015	Journal of medicinal chemistry, Apr-09, Volume: 58, Issue:7	Design of a potent antibiotic peptide based on the active region of human defensin 5.
AID1516066	Antibacterial activity against Escherichia coli ATCC 25922 in presence of H202 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1442118	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of NH4Cl by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1691352	Hemolytic activity in sheep RBC assessed as hemolysis at 4 ug/ml measured after 2 hrs by ELISA relative to control	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1524082	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 4 mg/ml chymotrypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369486	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of 50% human heat-inactivated serum by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1442091	Antibacterial activity against gentamicin-resistant Pseudomonas aeruginosa 11421 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID140051	Compound was tested for sublethal concentrations in 3T3 mouse fibroblast lysis.	1996	Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16	De novo antimicrobial peptides with low mammalian cell toxicity.
AID1433372	Antimicrobial activity against Staphylococcus aureus KCTC 1621 incubated for 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1691358	Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in microbial growth incubated for 18 to 24 hrs by broth microdilution method	2020	European journal of medicinal chemistry, May-01, Volume: 193	Antibacterial AZT derivative regulates metastasis of breast cancer cells.
AID1916060	Antibacterial activity against Acinetobacter baumannii ATCC 17978 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1701042	Induction of outer membrane permeability in Escherichia coli assessed as periplasmic-beta-lactamase release at 5 uM using CENTA	2020	Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23	Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1605787	Cytotoxicity against HDF cells assessed as minimum cytotoxic concentration incubated for 24 hrs by MTS assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1442087	Antibacterial activity against Pseudomonas aeruginosa CICC 10419 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1765594	Antibacterial activity against Gram-negative bacteria incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1369468	Fungicidal activity against Candida parapsilosis cgmcc 2.3989 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674643	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of pepsin by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524043	Antimicrobial activity against Salmonella typhimurium ATCC 14028 after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1516052	Antibacterial activity against Escherichia coli ATCC 25922 in presence of NaCl by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1916056	Antibacterial activity against methicillin-resistant Staphylococcus aureus NCTC10442 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1674694	Induction of outer membrane permeabilization in Escherichia coli ATCC 25922 after 30 mins by NPN-dye based assay	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1527500	Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in microbial growth incubated for 18 to 24 hrs by two-fold serial dilution method	2020	European journal of medicinal chemistry, Jan-01, Volume: 185	Structure-activity relationships (SAR) of triazine derivatives: Promising antimicrobial agents.
AID1707854	Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for methicillin-resistant Staphylococcus aureus 75	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID710131	Antibacterial activity against Listeria monocytogenes SOR 100 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1674584	Therapeutic index, ratio of MHC for human RBC to geometric mean of peptide MIC for methicillin-resistant Staphylococcus aureus 43300	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1063816	Antibacterial activity against Escherichia coli by broth microdilution method	2014	Bioorganic & medicinal chemistry letters, Jan-15, Volume: 24, Issue:2	Dimeric unnatural polyproline-rich peptides with enhanced antibacterial activity.
AID1553892	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli ATCC 25922	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735108	Antibacterial activity against Salmonella enteritidis CICC 21527 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1674615	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 150 mM Na+ by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524134	Bactericidal activity against Salmonella pullorum C7913 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1369489	Antifungal activity against Candida albicans cgmcc 2.2086 in presence of 50% human heat-inactivated serum by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707928	Induction of cytoplasmic membrane disruption in Staphylococcus aureus ATCC 25923 measured for 15 mins by DiSC3-5 dye based fluorescence assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1129356	Cytotoxicity against mouse NIH/3T3 cells after 1 hr by MTS/PMS assay	2014	Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7	Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1369467	Fungicidal activity against Candida krusei cgmcc 2.1857 after 96 hrs	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1516095	Inhibition of swimming motility of Escherichia coli ATCC 25922 at 1 to 4 uM after 16 hrs	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1569930	Hemolytic activity in human Erythrocyte at 1 uM measured after 1 hr relative to control	2019	European journal of medicinal chemistry, Oct-15, Volume: 180	Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID1553903	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Staphylococcus aureus ATCC 25923	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524084	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 1 mg/ml chymotrypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553792	Bactericidal activity against Salmonella typhimurium C7731 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1524071	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of NH4Cl	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1433376	Therapeutic index, ratio of MHC for sheep RBC to MIC for Staphylococcus epidermidis KCTC 1917	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1369440	Bactericidal activity against methicillin-resistant Staphylococcus aureus ATCC 4330	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1553870	Induction of cytoplasmic membrane depolarization in Escherichia coli ATCC 25922 assessed as increase in ONPG release at 1 to 64 uM measured at 6 mins interval for 120 mins by spectroscopically	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1090766	Fungicidal activity against Penicillium digitatum PHI-26 conidia assessed as reduction in conidia viability at 4 uM incubated for 16 hr by colony count assay relative to untreated control	2007	Journal of agricultural and food chemistry, Oct-03, Volume: 55, Issue:20	Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum.
AID1423349	Cytotoxicity against human MM96L after 24 hrs by MTT assay	2018	Journal of natural products, 11-26, Volume: 81, Issue:11	Discovery and Characterization of Cyclotides from Rinorea Species.
AID1524123	Bactericidal activity against Escherichia coli 078 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1415094	Induction of membrane permeabilization in Staphylococcus aureus KCTC 1621 at 2 to 8 times MIC concentration up to 300 secs by SYTOX green uptake assay	2018	Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24	Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1524125	Bactericidal activity against Escherichia coli K99 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1553899	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against Escherichia coli 078	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1827099	Hemolytic activity in human RBC assessed as hemoglobin release at pH 7.4 incubated for 1 hr	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1553781	Antifungal activity against Candida albicans cgmcc2.2086 measured after 48 hrs by broth microdilution method	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735109	Antibacterial activity against Vibrio parahaemolyticus CICC 21617 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1442121	Antibacterial activity against Pseudomonas aeruginosa ATCC 27853 after 18 hrs in presence of FeCl3 by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1916061	Antibacterial activity against Acinetobacter baumannii R2889 assessed as inhibition of bacterial growth incubated for 24 hrs by CLSI based broth dilution method
AID1707860	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of CaCl2 by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID704828	Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as mortality at 0.5 to 5 mg/kg, sc qd for 18 days	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID710195	Antibacterial activity against Lactococcus garvieae ATCC 43921 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID1369469	Hemolytic activity in human RBC after 1 hr	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707848	Antimicrobial activity against methicillin-resistant Staphylococcus aureus 113 after 18 hrs by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1553794	Bactericidal activity against Staphylococcus epidermidis ATCC 12228 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735117	Antibacterial activity against Pseudomonas fluorescens CICC 21620 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1735124	Therapeutic index, ratio of MHC10 for human RBC to geometric mean of peptide MIC for Salmonella paratyphi A CICC 20501	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1553791	Bactericidal activity against Escherichia coli 078 incubated for 24 hrs followed by replating on agar plate and measured after overnight incubation	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1433384	Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 after 18 to 20 hrs by broth microdilution assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1369435	Bactericidal activity against Escherichia coli ATCC 25922	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1524070	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of FeCl3	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674630	Antibacterial activity against Escherichia coli ATCC 25922 after 18 to 24 hrs in presence of 100% human serum by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1524047	Antimicrobial activity against Klebsiella pneumoniae after 24 hrs by NCCLS-protocol based assay	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524145	Stability of the compound assessed as chymotrypsin (unknown origin)-mediated compound hydrolysis after 1 hrs by SDS-PAGE analysis	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1674644	Antibacterial activity against Escherichia coli ATCC 25922 measured after 18 to 24 hrs in presence of proteinase K by CLSI-based broth microdilution method	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID654512	Induction of apoptosis in human activated PBMC assessed as necrotic cells at 1.6 uM by annexinV/propidium iodide staining-based flow cytometric analysis	2012	Journal of natural products, Feb-24, Volume: 75, Issue:2	Do plant cyclotides have potential as immunosuppressant peptides?
AID1524074	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 25% serum albumin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID357100	Cytotoxicity against human HeLa cells at 100 ug/ml after 24 hrs by MTT assay relative to control	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID1707857	Antimicrobial activity against Staphylococcus aureus ATCC 25923 after 18 hrs in presence of KCl by broth microdilution method	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516117	Antibacterial activity against Pseudomonas aeruginosa PAO1 at sub-MIC treated over 35 serial passages by resistant development assay	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1701047	Induction of outer membrane re-arragenemnts in Escherichia coli D21f2 incubated for 4 mins by NPN uptake assay	2020	Journal of medicinal chemistry, 12-10, Volume: 63, Issue:23	Proline Hinged Amphipathic α-Helical Peptide Sensitizes Gram-Negative Bacteria to Various Gram-Positive Antibiotics.
AID1524068	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of CaCl2	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1765577	Antibacterial activity against Escherichia coli ATCC 25922 incubated for 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1516060	Antibacterial activity against Escherichia coli ATCC 25922 in presence of 25% serum by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1661691	Microbicidal activity against Staphylococcus aureus ATCC 6538 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID1553901	Therapeutic index, ratio of MHC10 for hemolytic activity in human RBC to MIC95 against methicillin-resistant Staphylococcus aureus ATCC 43300	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1735100	Antibacterial activity against Escherichia coli ATCC 25922 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524136	Bactericidal activity against Klebsiella pneumoniae incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1916058	Hemolytic activity in rabbit RBC measured after 1 hrs by multimode reader assay
AID1369533	Antifungal activity against Candida albicans 58288 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1707866	Ratio of MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in presence of 5% serum to MIC for antimicrobial activity against Staphylococcus aureus ATCC 25923 in absence of serum	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID409501	Toxicity in human erythrocytes assessed as hemolytic activity at 3.5 uM	2008	Journal of medicinal chemistry, Dec-25, Volume: 51, Issue:24	Engineering stabilized vascular endothelial growth factor-A antagonists: synthesis, structural characterization, and bioactivity of grafted analogues of cyclotides.
AID1569926	Antibacterial activity against Bacillus subtilis 168 HT assessed as reduction in bacterial cell growth incubated for 24 hrs by microtiter dilution method	2019	European journal of medicinal chemistry, Oct-15, Volume: 180	Medicinal leech antimicrobial peptides lacking toxicity represent a promising alternative strategy to combat antibiotic-resistant pathogens.
AID1516068	Antibacterial activity against Staphylococcus aureus ATCC 29213 using preheated compound at 100 degreeC for 1 hr by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1661692	Microbicidal activity against Enterococcus faecalis ATCC 29121 assessed as inhibition of colony growth incubated for 24 hrs followed by replating and further incubated for 24 hrs	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Tailoring the Physicochemical Properties of Antimicrobial Peptides onto a Thiazole-Based γ-Peptide Foldamer.
AID704803	Down regulation of VEGFA-stimulated COX2 expression in HUVEC at 5 to 20 uM after 24 hrs by Western blot analysis in presence of p38 inhibitor SB203580	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID1524062	Selectivity ratio of HC10 for human RBC to geometric mean of the peptide MBC for bacteria	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1741114	Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as reduction in bacterial growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID710130	Antibacterial activity against Escherichia coli ATCC 25922 after 48 hrs by microtiter broth dilution method	2012	Journal of medicinal chemistry, Dec-27, Volume: 55, Issue:24	De novo cyclic pseudopeptides containing aza-β3-amino acids exhibiting antimicrobial activities.
AID378686	Toxicity against human type A red blood cells assessed as hemolytic activity after 1hr	2006	Journal of natural products, Jan, Volume: 69, Issue:1	Cycloviolacin H4, a hydrophobic cyclotide from Viola hederaceae.
AID1553773	Antibacterial activity against Escherichia coli K88 measured after 24 hrs	2019	Journal of medicinal chemistry, 05-09, Volume: 62, Issue:9	Rational Design of Short Peptide Variants by Using Kunitzin-RE, an Amphibian-Derived Bioactivity Peptide, for Acquired Potent Broad-Spectrum Antimicrobial and Improved Therapeutic Potential of Commensalism Coinfection of Pathogens.
AID1516051	Antibacterial activity against Escherichia coli ATCC 25922 using preheated compound at 100 degreeC for 1 hr by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1707878	Antimicrobial activity against Staphylococcus aureus ATCC 25923 assessed as bacterial killing at MIC preincubated for 4 hrs followed by replating on MHB agar and measured after 24 hrs by time kill assay	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1369453	Antifungal activity against Candida tropicalis cgmcc 2.1975 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1765593	Selectivity ratio of MHC10 for BALB/C mouse erythrocytes to MIC for gram positive bacteria	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
AID1369475	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs in presence of ZnCl2 by broth dilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1605812	Induction of pore formation in intact Acinetobacter baumannii 1001 cell membrane assessed as SG uptake at 2 times MIC by SG dye based fluorescence based assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID704823	Toxicity in VEGFA-stimulated mouse highly metastatic LLC cells xenografted C57BL/6 mouse assessed as mortality at 0.5 to 5 mg/kg, sc qd for 7 days	2012	Journal of natural products, Nov-26, Volume: 75, Issue:11	Melittin suppresses VEGF-A-induced tumor growth by blocking VEGFR-2 and the COX-2-mediated MAPK signaling pathway.
AID131991	Concentration required for half-maximal lysis of mouse erythrocytes; NA = not active	2004	Bioorganic & medicinal chemistry letters, Mar-08, Volume: 14, Issue:5	Development of novel lipid-peptide hybrid compounds with antibacterial activity from natural cationic antibacterial peptides.
AID1605843	Cytotoxicity against HDF cells assessed as minimum cytotoxic concentration incubated for 24 hrs by Alexa Fluor 569 phalloidin-FITC/Hoescht dye staining based fluorescence microscopic analysis	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1707853	Therapeutic index, ratio of MHC for mouse RBC to geometric mean of peptide MIC for Bacillus subtilis ATCC 23857	2021	European journal of medicinal chemistry, Feb-15, Volume: 212	Ultra-short lipopeptides against gram-positive bacteria while alleviating antimicrobial resistance.
AID1516058	Antibacterial activity against Escherichia coli ATCC 25922 in presence of FeCl3 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1129358	Hemolytic activity in human RBC after 1 hr	2014	Journal of medicinal chemistry, Apr-10, Volume: 57, Issue:7	Tailoring cytotoxicity of antimicrobial peptidomimetics with high activity against multidrug-resistant Escherichia coli.
AID1369509	Disruption of cytoplasmic membrane electrical potential in Candida albicans cgmcc 2.2086 at MFC after 800 secs by DiSC3-5 dye-based fluorescence spectrophotometric method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1674618	Hemolytic activity in human RBC assessed as hemolysis at 1 uM relative to control	2020	Journal of medicinal chemistry, 09-10, Volume: 63, Issue:17	Rational Avoidance of Protease Cleavage Sites and Symmetrical End-Tagging Significantly Enhances the Stability and Therapeutic Potential of Antimicrobial Peptides.
AID1469647	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs by microdilution method	2018	Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7	Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1735110	Antibacterial activity against Staphylococcus aureus ATCC 29213 assessed as bacterial growth inhibition incubated for 18 to 24 hrs by microtiter broth dilution method	2016	Journal of medicinal chemistry, 12-22, Volume: 59, Issue:24	Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles.
AID1524083	Bactericidal activity against Escherichia coli ATCC 25922 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight in presence of 2 mg/ml chymotrypsin	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1423351	Cytotoxicity against human HT-29 after 24 hrs by MTT assay	2018	Journal of natural products, 11-26, Volume: 81, Issue:11	Discovery and Characterization of Cyclotides from Rinorea Species.
AID1369444	Antifungal activity against Candida albicans SP3931 after 48 hrs by broth microdilution method	2018	Journal of medicinal chemistry, 05-10, Volume: 61, Issue:9	Combating Drug-Resistant Fungi with Novel Imperfectly Amphipathic Palindromic Peptides.
AID1442084	Antibacterial activity against Escherichia coli ATCC 25922 after 18 hrs by broth microdilution method	2017	Journal of medicinal chemistry, 03-23, Volume: 60, Issue:6	Novel Design of Heptad Amphiphiles To Enhance Cell Selectivity, Salt Resistance, Antibiofilm Properties and Their Membrane-Disruptive Mechanism.
AID1516084	Resistance index, ratio of MIC for antibacterial activity against Escherichia coli ATCC 25922 treated over 35 serial passage by sequential passaging method to MIC for antibacterial activity against Escherichia coli ATCC 25922 incubated for 18 to 24 hrs by	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1516072	Antibacterial activity against Staphylococcus aureus ATCC 29213 in presence of MgCl2 by broth microdilution method	2019	Journal of medicinal chemistry, 08-08, Volume: 62, Issue:15	Design of Trp-Rich Dodecapeptides with Broad-Spectrum Antimicrobial Potency and Membrane-Disruptive Mechanism.
AID1524053	Ratio of MBC against Pseudomonas aeruginosa ATCC 27853 after 50 passages to MBC against Pseudomonas aeruginosa ATCC 27853	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1415093	Induction of cytoplasmic membrane depolarization in Staphylococcus aureus KCTC 1621 at 2 times MIC concentration by DiSC3(5)-dye based fluorescence spectrophotometry	2018	Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24	Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1433397	Induction of cytoplasmic membrane depolarization in Staphylococcus aureus KCTC 1621 assessed as loss of membrane potential after 1 hr by DiSC3(5) dye based fluorescence assay	2017	European journal of medicinal chemistry, Jan-05, Volume: 125	Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID357107	Antibacterial activity against Brucella abortus 9.49 (per-) after 48 hrs in Mueller-Hinton broth medium	2007	The Journal of biological chemistry, May-18, Volume: 282, Issue:20	Rationale for the design of shortened derivatives of the NK-lysin-derived antimicrobial peptide NK-2 with improved activity against Gram-negative pathogens.
AID91128	Compound was measured for sublethal concentrations (uM) in Human erythrocytes	1996	Journal of medicinal chemistry, Aug-02, Volume: 39, Issue:16	De novo antimicrobial peptides with low mammalian cell toxicity.
AID1827112	Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 assessed as reduction in bacterial growth at pH 7.4 in presence of CaCl2	2022	Journal of medicinal chemistry, 04-14, Volume: 65, Issue:7	pH-Responsive Antimicrobial Peptide with Selective Killing Activity for Bacterial Abscess Therapy.
AID1605809	Antibacterial activity against Klebsiella pneumoniae 1008 assessed as reduction in bacterial viability at 2 or 4 times MIC incubated up to 24 hrs in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by time kill kinetics assay	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1741126	Antifungal activity against Candida albicans KCTC 7121 assessed as reduction in fungal growth incubated for 24 hrs by CLSI based broth dilution method	2020	European journal of medicinal chemistry, Oct-15, Volume: 204	Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1524122	Bactericidal activity against Escherichia coli UB1005 incubated for 4 hrs followed by culture spread on agar plates and cultured overnight	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1524063	Selectivity ratio of IC50 for mouse RAW264.7 cells to geometric mean of the peptide MBC for bacteria	2019	Journal of medicinal chemistry, 03-14, Volume: 62, Issue:5	Antimicrobial Peptides with High Proteolytic Resistance for Combating Gram-Negative Bacteria.
AID1605804	Antibacterial activity against vancomycin-resistant Enterococcus faecalis ATCC 29212 assessed as log10 reduction in bacterial viability at 2 to 4 times MIC incubated for 30 mins in MHB medium followed by reincubation on MH agar plate for 24 to 48 hrs by t	2020	Journal of medicinal chemistry, 04-09, Volume: 63, Issue:7	Rational Substitution of ε-Lysine for α-Lysine Enhances the Cell and Membrane Selectivity of Pore-Forming Melittin.
AID1469687	Induction of membrane permeabilization in Escherichia coli ATCC 25922 assessed as loss of pili/flagella at MBC after 1 hr by atomic force microscopic method	2018	Journal of medicinal chemistry, 04-12, Volume: 61, Issue:7	Antibacterial Activity Affected by the Conformational Flexibility in Glycine-Lysine Based α-Helical Antimicrobial Peptides.
AID1765608	Antibacterial activity against Staphylococcus aureus ATCC 25923 incubated with 0.02 ug/ml trypsin for 6 hrs followed by bacterial addition and measured after 18 hrs by CLSI based broth dilution method	2021	Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15	Novel Broad-Spectrum Antimicrobial Peptide Derived from Anoplin and Its Activity on Bacterial Pneumonia in Mice.
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023]

Timeframe	Studies, This Drug (%)	All Drugs %
pre-1990	3 (4.41)	18.7374
1990's	1 (1.47)	18.2507
2000's	8 (11.76)	29.6817
2010's	35 (51.47)	24.3611
2020's	21 (30.88)	2.80
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Publication Type	This drug (%)	All Drugs (%)
Trials	0 (0.00%)	5.53%
Reviews	4 (5.88%)	6.00%
Case Studies	0 (0.00%)	4.05%
Observational	0 (0.00%)	0.25%
Other	64 (94.12%)	84.16%
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Substance	Relationship Strength	Studies	Classes	Roles
catechol [no description available]	3.31	1	catechols	allelochemical; genotoxin; plant metabolite
salicylic acid Scalp: The outer covering of the calvaria. It is composed of several layers: SKIN; subcutaneous connective tissue; the occipitofrontal muscle which includes the tendinous galea aponeurotica; loose connective tissue; and the pericranium (the PERIOSTEUM of the SKULL).	1.93	1	monohydroxybenzoic acid	algal metabolite; antifungal agent; antiinfective agent; EC 1.11.1.11 (L-ascorbate peroxidase) inhibitor; keratolytic drug; plant hormone; plant metabolite
hydroquinone [no description available]	3.31	1	benzenediol; hydroquinones	antioxidant; carcinogenic agent; cofactor; Escherichia coli metabolite; human xenobiotic metabolite; mouse metabolite; skin lightening agent
catechin [no description available]	3.31	1	hydroxyflavan
amantadine amant: an antiviral compound consisting of an adamantane derivative chemically linked to a water-solube polyanioic matrix; structure in first source	3.31	1	adamantanes; primary aliphatic amine	analgesic; antiparkinson drug; antiviral drug; dopaminergic agent; NMDA receptor antagonist; non-narcotic analgesic
ciprofloxacin Ciprofloxacin: A broad-spectrum antimicrobial carboxyfluoroquinoline.. ciprofloxacin : A quinolone that is quinolin-4(1H)-one bearing cyclopropyl, carboxylic acid, fluoro and piperazin-1-yl substituents at positions 1, 3, 6 and 7, respectively.	5.17	12	aminoquinoline; cyclopropanes; fluoroquinolone antibiotic; N-arylpiperazine; quinolinemonocarboxylic acid; quinolone antibiotic; quinolone; zwitterion	antibacterial drug; antiinfective agent; antimicrobial agent; DNA synthesis inhibitor; EC 5.99.1.3 [DNA topoisomerase (ATP-hydrolysing)] inhibitor; environmental contaminant; topoisomerase IV inhibitor; xenobiotic
fluconazole Fluconazole: Triazole antifungal agent that is used to treat oropharyngeal CANDIDIASIS and cryptococcal MENINGITIS in AIDS.. fluconazole : A member of the class of triazoles that is propan-2-ol substituted at position 1 and 3 by 1H-1,2,4-triazol-1-yl groups and at position 2 by a 2,4-difluorophenyl group. It is an antifungal drug used for the treatment of mucosal candidiasis and for systemic infections including systemic candidiasis, coccidioidomycosis, and cryptococcosis.	4.6	6	conazole antifungal drug; difluorobenzene; tertiary alcohol; triazole antifungal drug	environmental contaminant; P450 inhibitor; xenobiotic
isoniazid Hydra: A genus of freshwater polyps in the family Hydridae, order Hydroida, class HYDROZOA. They are of special interest because of their complex organization and because their adult organization corresponds roughly to the gastrula of higher animals.. hydrazide : Compounds derived from oxoacids RkE(=O)l(OH)m (l =/= 0) by replacing -OH by -NRNR2 (R groups are commonly H). (IUPAC).	3.31	1	carbohydrazide	antitubercular agent; drug allergen
nalidixic acid [no description available]	2.89	3	1,8-naphthyridine derivative; monocarboxylic acid; quinolone antibiotic	antibacterial drug; antimicrobial agent; DNA synthesis inhibitor
norfloxacin Norfloxacin: A synthetic fluoroquinolone (FLUOROQUINOLONES) with broad-spectrum antibacterial activity against most gram-negative and gram-positive bacteria. Norfloxacin inhibits bacterial DNA GYRASE.. norfloxacin : A quinolinemonocarboxylic acid with broad-spectrum antibacterial activity against most gram-negative and gram-positive bacteria. Norfloxacin is bactericidal and its mode of action depends on blocking of bacterial DNA replication by binding itself to an enzyme called DNA gyrase.	2.66	2	fluoroquinolone antibiotic; N-arylpiperazine; quinolinemonocarboxylic acid; quinolone antibiotic; quinolone	antibacterial drug; DNA synthesis inhibitor; environmental contaminant; xenobiotic
n-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide: structure given in first source. NS-398 : A C-nitro compound that is N-methylsulfonyl-4-nitroaniline bearing an additional cyclohexyloxy substituent at position 2.	2.07	1	aromatic ether; C-nitro compound; sulfonamide	antineoplastic agent; cyclooxygenase 2 inhibitor
ofloxacin Ofloxacin: A synthetic fluoroquinolone antibacterial agent that inhibits the supercoiling activity of bacterial DNA GYRASE, halting DNA REPLICATION.. 9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid : An oxazinoquinoline that is 2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinolin-7-one substituted by methyl, carboxy, fluoro, and 4-methylpiperazin-1-yl groups at positions 3, 6, 9, and 10, respectively.. ofloxacin : A racemate comprising equimolar amounts of levofloxacin and dextrofloxacin. It is a synthetic fluoroquinolone antibacterial agent which inhibits the supercoiling activity of bacterial DNA gyrase, halting DNA replication.	2.59	2	3-oxo monocarboxylic acid; N-arylpiperazine; N-methylpiperazine; organofluorine compound; oxazinoquinoline
resorcinol resorcinol: RN given refers to parent cpd; structure in Merck Index, 9th ed, #7951. resorcinol : A benzenediol that is benzene dihydroxylated at positions 1 and 3.	3.31	1	benzenediol; phenolic donor; resorcinols	erythropoietin inhibitor; sensitiser
rimantadine Rimantadine: An RNA synthesis inhibitor that is used as an antiviral agent in the prophylaxis and treatment of influenza.	3.31	1	alkylamine
gatifloxacin Gatifloxacin: A fluoroquinolone antibacterial agent and DNA TOPOISOMERASE II inhibitor that is used as an ophthalmic solution for the treatment of BACTERIAL CONJUNCTIVITIS.. gatifloxacin : A monocarboxylic acid that is 4-oxo-1,4-dihydroquinoline-3-carboxylic acid which is substituted on the nitrogen by a cyclopropyl group and at positions 6, 7, and 8 by fluoro, 3-methylpiperazin-1-yl, and methoxy groups, respectively. Gatifloxacin is an antibiotic of the fourth-generation fluoroquinolone family, that like other members of that family, inhibits the bacterial topoisomerase type-II enzymes.	2.25	1	N-arylpiperazine; organofluorine compound; quinolinemonocarboxylic acid; quinolone antibiotic; quinolone	antiinfective agent; antimicrobial agent; EC 5.99.1.3 [DNA topoisomerase (ATP-hydrolysing)] inhibitor
penicillin g Penicillin G: A penicillin derivative commonly used in the form of its sodium or potassium salts in the treatment of a variety of infections. It is effective against most gram-positive bacteria and against gram-negative cocci. It has also been used as an experimental convulsant because of its actions on GAMMA-AMINOBUTYRIC ACID mediated synaptic transmission.. benzylpenicillin : A penicillin in which the substituent at position 6 of the penam ring is a phenylacetamido group.	2.31	1	penicillin allergen; penicillin	antibacterial drug; drug allergen; epitope
chloramphenicol Amphenicol: Chloramphenicol and its derivatives.	3.48	6	C-nitro compound; carboxamide; diol; organochlorine compound	antibacterial drug; antimicrobial agent; Escherichia coli metabolite; geroprotector; Mycoplasma genitalium metabolite; protein synthesis inhibitor
cetrimonium bromide cetyltrimethylammonium bromide : The organic bromide salt that is the bromide salt of cetyltrimethylammonium; one of the components of the topical antiseptic cetrimide.	2.21	1	organic bromide salt; quaternary ammonium salt	detergent; surfactant
kanamycin a Kanamycin: Antibiotic complex produced by Streptomyces kanamyceticus from Japanese soil. Comprises 3 components: kanamycin A, the major component, and kanamycins B and C, the minor components.. kanamycin : Kanamycin is a naturally occurring antibiotic complex from Streptomyces kanamyceticus that consists of several components: kanamycin A, the major component (also usually designated as kanamycin), and kanamycins B, C, D and X the minor components.	2.76	2	kanamycins	bacterial metabolite
edetic acid Edetic Acid: A chelating agent that sequesters a variety of polyvalent cations such as CALCIUM. It is used in pharmaceutical manufacturing and as a food additive.	2.05	1	ethylenediamine derivative; polyamino carboxylic acid; tetracarboxylic acid	anticoagulant; antidote; chelator; copper chelator; geroprotector
oxacillin Oxacillin: An antibiotic similar to FLUCLOXACILLIN used in resistant staphylococci infections.. oxacillin : A penicillin antibiotic carrying a 5-methyl-3-phenylisoxazole-4-carboxamide group at position 6beta.	2.63	2	penicillin	antibacterial agent; antibacterial drug
ampicillin Ampicillin: Semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic.. ampicillin : A penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group.	4.03	3	beta-lactam antibiotic; penicillin allergen; penicillin	antibacterial drug
framycetin Framycetin: A component of NEOMYCIN that is produced by Streptomyces fradiae. On hydrolysis it yields neamine and neobiosamine B. (From Merck Index, 11th ed). framycetin : A tetracyclic antibacterial agent derived from neomycin, being a glycoside ester of neamine and neobiosamine B.	2.41	1	aminoglycoside	allergen; antibacterial drug; Escherichia coli metabolite
podophyllotoxin Podophyllum: A genus of poisonous American herbs, family BERBERIDACEAE. The roots yield PODOPHYLLOTOXIN and other pharmacologically important agents. The plant was formerly used as a cholagogue and cathartic. It is different from the European mandrake, MANDRAGORA.	2.21	1	furonaphthodioxole; lignan; organic heterotetracyclic compound	antimitotic; antineoplastic agent; keratolytic drug; microtubule-destabilising agent; plant metabolite; tubulin modulator
hesperidin Hesperidin: A flavanone glycoside found in CITRUS fruit peels.. hesperidin : A disaccharide derivative that consists of hesperetin substituted by a 6-O-(alpha-L-rhamnopyranosyl)-beta-D-glucopyranosyl moiety at position 7 via a glycosidic linkage.	3.31	1	3'-hydroxyflavanones; 4'-methoxyflavanones; dihydroxyflavanone; disaccharide derivative; flavanone glycoside; monomethoxyflavanone; rutinoside	mutagen
erythromycin Erythromycin: A bacteriostatic antibiotic macrolide produced by Streptomyces erythreus. Erythromycin A is considered its major active component. In sensitive organisms, it inhibits protein synthesis by binding to 50S ribosomal subunits. This binding process inhibits peptidyl transferase activity and interferes with translocation of amino acids during translation and assembly of proteins.. erythromycin : Any of several wide-spectrum macrolide antibiotics obtained from actinomycete Saccharopolyspora erythraea (formerly known as Streptomyces erythraeus).. erythromycin A : An erythromycin that consists of erythronolide A having 2,6-dideoxy-3-C-methyl-3-O-methyl-alpha-L-ribo-hexopyranosyl and 3,4,6-trideoxy-3-(dimethylamino)-beta-D-xylo-hexopyranosyl residues attahced at positions 4 and 6 respectively.	2.94	3	cyclic ketone; erythromycin
vancomycin Vancomycin: Antibacterial obtained from Streptomyces orientalis. It is a glycopeptide related to RISTOCETIN that inhibits bacterial cell wall assembly and is toxic to kidneys and the inner ear.. vancomycin : A complex glycopeptide from Streptomyces orientalis. It inhibits a specific step in the synthesis of the peptidoglycan layer in the Gram-positive bacteria Staphylococcus aureus and Clostridium difficile.	4.24	14	glycopeptide	antibacterial drug; antimicrobial agent; bacterial metabolite
streptomycin [no description available]	3.73	2	antibiotic antifungal drug; antibiotic fungicide; streptomycins	antibacterial drug; antifungal agrochemical; antimicrobial agent; antimicrobial drug; bacterial metabolite; protein synthesis inhibitor
ampicillin trihydrate [no description available]	3.35	1	hydrate
camptothecin NSC 100880: carboxylate (opened lactone) form of camptothecin; RN refers to (S)-isomer; structure given in first source	2.07	1	delta-lactone; pyranoindolizinoquinoline; quinoline alkaloid; tertiary alcohol	antineoplastic agent; EC 5.99.1.2 (DNA topoisomerase) inhibitor; genotoxin; plant metabolite
paclitaxel Taxus: Genus of coniferous yew trees or shrubs, several species of which have medicinal uses. Notable is the Pacific yew, Taxus brevifolia, which is used to make the anti-neoplastic drug taxol (PACLITAXEL).	2.17	1	taxane diterpenoid; tetracyclic diterpenoid	antineoplastic agent; human metabolite; metabolite; microtubule-stabilising agent
amikacin Amikacin: A broad-spectrum antibiotic derived from KANAMYCIN. It is reno- and oto-toxic like the other aminoglycoside antibiotics.. amikacin : An amino cyclitol glycoside that is kanamycin A acylated at the N-1 position by a 4-amino-2-hydroxybutyryl group.	2.21	1	alpha-D-glucoside; amino cyclitol glycoside; aminoglycoside; carboxamide	antibacterial drug; antimicrobial agent; nephrotoxin
epigallocatechin gallate epigallocatechin gallate: a steroid 5alpha-reductase inhibitor and antimutagen in green tea (Camellia sinensis). (-)-epigallocatechin 3-gallate : A gallate ester obtained by the formal condensation of gallic acid with the (3R)-hydroxy group of (-)-epigallocatechin.	3.31	1	flavans; gallate ester; polyphenol	antineoplastic agent; antioxidant; apoptosis inducer; geroprotector; Hsp90 inhibitor; neuroprotective agent; plant metabolite
gentamicin c1 [no description available]	2.76	2
gentamicin c1a [no description available]	3.61	7	gentamycin C
squalamine squalamine: from dogfish shark Squalus acanthias; structure given in first source	2.21	1	bile acid
2-(salicylideneamino)phenol 2-(salicylideneamino)phenol: structure given in first source	3.31	1
podocarpic acid podocarpic acid: structure. podocarpic acid : An abietane diterpenoid lacking the isopropyl substituent with an aromatic C-ring and a hydroxy group at the 12-position.	2.41	1	abietane diterpenoid
imipenem, anhydrous Imipenem: Semisynthetic thienamycin that has a wide spectrum of antibacterial activity against gram-negative and gram-positive aerobic and anaerobic bacteria, including many multiresistant strains. It is stable to beta-lactamases. Clinical studies have demonstrated high efficacy in the treatment of infections of various body systems. Its effectiveness is enhanced when it is administered in combination with CILASTATIN, a renal dipeptidase inhibitor.. imipenem : A broad-spectrum, intravenous beta-lactam antibiotic of the carbapenem subgroup.	2.31	1	beta-lactam antibiotic allergen; carbapenems; zwitterion	antibacterial drug
levofloxacin Levofloxacin: The L-isomer of Ofloxacin.. levofloxacin : An optically active form of ofloxacin having (S)-configuration; an inhibitor of bacterial topoisomerase IV and DNA gyrase.	5.01	5	9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid; fluoroquinolone antibiotic; quinolone antibiotic	antibacterial drug; DNA synthesis inhibitor; EC 5.99.1.3 [DNA topoisomerase (ATP-hydrolysing)] inhibitor; topoisomerase IV inhibitor
moxifloxacin Moxifloxacin: A fluoroquinolone that acts as an inhibitor of DNA TOPOISOMERASE II and is used as a broad-spectrum antibacterial agent.. moxifloxacin : A quinolone that consists of 4-oxo-1,4-dihydroquinoline-3-carboxylic acid bearing a cyclopropyl substituent at position 1, a fluoro substitiuent at position 6, a (4aS,7aS)-octahydro-6H-pyrrolo[3,4-b]pyridin-6-yl group at position 7 and a methoxy substituent at position 8. A member of the fluoroquinolone class of antibacterial agents.	2.25	1	aromatic ether; cyclopropanes; fluoroquinolone antibiotic; pyrrolidinopiperidine; quinolinemonocarboxylic acid; quinolone antibiotic; quinolone	antibacterial drug
meropenem Meropenem: A thienamycin derivative antibacterial agent that is more stable to renal dehydropeptidase I than IMIPENEM, but does not need to be given with an enzyme inhibitor such as CILASTATIN. It is used in the treatment of bacterial infections, including infections in immunocompromised patients.. meropenem : A carbapenemcarboxylic acid in which the azetidine and pyrroline rings carry 1-hydroxymethyl and in which the azetidine and pyrroline rings carry 1-hydroxymethyl and 5-(dimethylcarbamoyl)pyrrolidin-3-ylthio substituents respectively.	3.07	3	alpha,beta-unsaturated monocarboxylic acid; carbapenemcarboxylic acid; organic sulfide; pyrrolidinecarboxamide	antibacterial agent; antibacterial drug; drug allergen
linezolid [no description available]	3.78	2	acetamides; morpholines; organofluorine compound; oxazolidinone	antibacterial drug; protein synthesis inhibitor
betadex beta-Cyclodextrins: Cyclic GLUCANS consisting of seven (7) glucopyranose units linked by 1,4-glycosidic bonds.	2.17	1	cyclodextrin
resveratrol trans-resveratrol : A resveratrol in which the double bond has E configuration.	3.31	1	resveratrol	antioxidant; phytoalexin; plant metabolite; quorum sensing inhibitor; radical scavenger
ketoconazole (2R,4S)-ketoconazole : A cis-1-acetyl-4-(4-{[2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine which dioxolane moiety has (2R,4S)-configuration.	2.17	1	cis-1-acetyl-4-(4-{[2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine
3,3',4,5'-tetrahydroxystilbene 3,3',4,5'-tetrahydroxystilbene: demethyl derivative of isorhapontigenin; structure in first source; a Syk kinase inhibitor; found in heartwood of FABACEAE; inhibitor of photosynthesis in spinach chloroplasts; may be inhibitor of plant growth; RN given refers to (E)-isomer. piceatannol : A stilbenol that is trans-stilbene in which one of the phenyl groups is substituted by hydroxy groups at positions 3 and 4, while the other phenyl group is substituted by hydroxy groups at positions 3 and 5.	3.31	1	catechols; polyphenol; resorcinols; stilbenol	antineoplastic agent; apoptosis inducer; geroprotector; hypoglycemic agent; plant metabolite; protein kinase inhibitor; tyrosine kinase inhibitor
N2,N4-ditert-butyl-6-hydrazinyl-1,3,5-triazine-2,4-diamine [no description available]	3.35	1	diamino-1,3,5-triazine
curcumin Curcumin: A yellow-orange dye obtained from tumeric, the powdered root of CURCUMA longa. It is used in the preparation of curcuma paper and the detection of boron. Curcumin appears to possess a spectrum of pharmacological properties, due primarily to its inhibitory effects on metabolic enzymes.. curcumin : A beta-diketone that is methane in which two of the hydrogens are substituted by feruloyl groups. A natural dyestuff found in the root of Curcuma longa.	3.31	1	aromatic ether; beta-diketone; diarylheptanoid; enone; polyphenol	anti-inflammatory agent; antifungal agent; antineoplastic agent; biological pigment; contraceptive drug; dye; EC 1.1.1.205 (IMP dehydrogenase) inhibitor; EC 1.1.1.21 (aldehyde reductase) inhibitor; EC 1.1.1.25 (shikimate dehydrogenase) inhibitor; EC 1.6.5.2 [NAD(P)H dehydrogenase (quinone)] inhibitor; EC 1.8.1.9 (thioredoxin reductase) inhibitor; EC 2.7.10.2 (non-specific protein-tyrosine kinase) inhibitor; EC 3.5.1.98 (histone deacetylase) inhibitor; flavouring agent; food colouring; geroprotector; hepatoprotective agent; immunomodulator; iron chelator; ligand; lipoxygenase inhibitor; metabolite; neuroprotective agent; nutraceutical; radical scavenger
tamoxifen [no description available]	3.2	4	stilbenoid; tertiary amino compound	angiogenesis inhibitor; antineoplastic agent; bone density conservation agent; EC 1.2.3.1 (aldehyde oxidase) inhibitor; EC 2.7.11.13 (protein kinase C) inhibitor; estrogen antagonist; estrogen receptor antagonist; estrogen receptor modulator
fusidic acid Fusidic Acid: An antibiotic isolated from the fermentation broth of Fusidium coccineum. (From Merck Index, 11th ed). It acts by inhibiting translocation during protein synthesis.. fusidic acid : A steroid antibiotic that is isolated from the fermentation broth of Fusidium coccineum.	2.41	1	11alpha-hydroxy steroid; 3alpha-hydroxy steroid; alpha,beta-unsaturated monocarboxylic acid; steroid acid; steroid antibiotic; sterol ester	EC 2.7.1.33 (pantothenate kinase) inhibitor; Escherichia coli metabolite; protein synthesis inhibitor
silybin [no description available]	3.31	1
quercetin [no description available]	3.31	1	7-hydroxyflavonol; pentahydroxyflavone	antibacterial agent; antineoplastic agent; antioxidant; Aurora kinase inhibitor; chelator; EC 1.10.99.2 [ribosyldihydronicotinamide dehydrogenase (quinone)] inhibitor; geroprotector; phytoestrogen; plant metabolite; protein kinase inhibitor; radical scavenger
apigenin Chamomile: Common name for several daisy-like plants (MATRICARIA; TRIPLEUROSPERMUM; ANTHEMIS; CHAMAEMELUM) native to Europe and Western Asia, now naturalized in the United States and Australia.	3.31	1	trihydroxyflavone	antineoplastic agent; metabolite
luteolin [no description available]	3.31	1	3'-hydroxyflavonoid; tetrahydroxyflavone	angiogenesis inhibitor; anti-inflammatory agent; antineoplastic agent; apoptosis inducer; c-Jun N-terminal kinase inhibitor; EC 2.3.1.85 (fatty acid synthase) inhibitor; immunomodulator; nephroprotective agent; plant metabolite; radical scavenger; vascular endothelial growth factor receptor antagonist
quercetin 3-o-glucopyranoside quercetin 3-O-glucopyranoside: structure in first source. quercetin 3-O-beta-D-glucopyranoside : A quercetin O-glucoside that is quercetin with a beta-D-glucosyl residue attached at position 3. Isolated from Lepisorus contortus, it exhibits antineoplastic activityand has been found to decrease the rate of polymerization and sickling of red blood cells	3.31	1	beta-D-glucoside; monosaccharide derivative; quercetin O-glucoside; tetrahydroxyflavone	antineoplastic agent; antioxidant; antipruritic drug; bone density conservation agent; geroprotector; histamine antagonist; osteogenesis regulator; plant metabolite
rutin Hydroxyethylrutoside: Monohydroxyethyl derivative of rutin. Peripheral circulation stimulant used in treatment of venous disorders.	3.31	1	disaccharide derivative; quercetin O-glucoside; rutinoside; tetrahydroxyflavone	antioxidant; metabolite
kaempferol [no description available]	3.31	1	7-hydroxyflavonol; flavonols; tetrahydroxyflavone	antibacterial agent; geroprotector; human blood serum metabolite; human urinary metabolite; human xenobiotic metabolite; plant metabolite
genistein [no description available]	3.31	1	7-hydroxyisoflavones	antineoplastic agent; EC 5.99.1.3 [DNA topoisomerase (ATP-hydrolysing)] inhibitor; geroprotector; human urinary metabolite; phytoestrogen; plant metabolite; tyrosine kinase inhibitor
amphotericin b Amphotericin B: Macrolide antifungal antibiotic produced by Streptomyces nodosus obtained from soil of the Orinoco river region of Venezuela.. amphotericin B : A macrolide antibiotic used to treat potentially life-threatening fungal infections.	3.05	4	antibiotic antifungal drug; macrolide antibiotic; polyene antibiotic	antiamoebic agent; antiprotozoal drug; bacterial metabolite
baicalein [no description available]	3.31	1	trihydroxyflavone	angiogenesis inhibitor; anti-inflammatory agent; antibacterial agent; anticoronaviral agent; antifungal agent; antineoplastic agent; antioxidant; apoptosis inducer; EC 1.13.11.31 (arachidonate 12-lipoxygenase) inhibitor; EC 1.13.11.33 (arachidonate 15-lipoxygenase) inhibitor; EC 3.4.21.26 (prolyl oligopeptidase) inhibitor; EC 3.4.22.69 (SARS coronavirus main proteinase) inhibitor; EC 4.1.1.17 (ornithine decarboxylase) inhibitor; ferroptosis inhibitor; geroprotector; hormone antagonist; plant metabolite; prostaglandin antagonist; radical scavenger
chrysin chrysin : A dihydroxyflavone in which the two hydroxy groups are located at positions 5 and 7.	3.31	1	7-hydroxyflavonol; dihydroxyflavone	anti-inflammatory agent; antineoplastic agent; antioxidant; EC 2.7.11.18 (myosin-light-chain kinase) inhibitor; hepatoprotective agent; plant metabolite
diosmin [no description available]	3.31	1	dihydroxyflavanone; disaccharide derivative; glycosyloxyflavone; monomethoxyflavone; rutinoside	anti-inflammatory agent; antioxidant
galangin 5,7-dihydroxyflavonol: antimicrobial from the twigs of Populus nigra x Populus deltoides; structure in first source. galangin : A 7-hydroxyflavonol with additional hydroxy groups at positions 3 and 5 respectively; a growth inhibitor of breast tumor cells.	3.31	1	7-hydroxyflavonol; trihydroxyflavone	antimicrobial agent; EC 3.1.1.3 (triacylglycerol lipase) inhibitor; plant metabolite
morin morin: a light yellowish pigment found in the wood of old fustic (Chlorophora tinctoria). morin : A pentahydroxyflavone that is 7-hydroxyflavonol bearing three additional hydroxy substituents at positions 2' 4' and 5.	3.31	1	7-hydroxyflavonol; pentahydroxyflavone	angiogenesis modulating agent; anti-inflammatory agent; antibacterial agent; antihypertensive agent; antineoplastic agent; antioxidant; EC 5.99.1.2 (DNA topoisomerase) inhibitor; hepatoprotective agent; metabolite; neuroprotective agent
daidzein [no description available]	3.31	1	7-hydroxyisoflavones	antineoplastic agent; EC 2.7.7.7 (DNA-directed DNA polymerase) inhibitor; EC 3.2.1.20 (alpha-glucosidase) inhibitor; phytoestrogen; plant metabolite
cerulenin Cerulenin: An epoxydodecadienamide isolated from several species, including ACREMONIUM, Acrocylindrum, and Helicoceras. It inhibits the biosynthesis of several lipids by interfering with enzyme function.. cerulenin : An epoxydodecadienamide isolated from several species, including Acremonium, Acrocylindrum and Helicoceras. It inhibits the biosynthesis of several lipids by interfering with enzyme function.	2.15	1	epoxide; monocarboxylic acid amide	antifungal agent; antiinfective agent; antilipemic drug; antimetabolite; antimicrobial agent; fatty acid synthesis inhibitor
cefixime [no description available]	3.35	1	cephalosporin	antibacterial drug; drug allergen
bedaquiline bedaquiline: a diarylquinoline Antitubercular Agent. bedaquiline : A quinoline-based antimycobacterial drug used (as its fumarate salt) for the treatment of pulmonary multi-drug resistant tuberculosis by inhibition of ATP synthase, an enzyme essential for the replication of the mycobacteria.	3.31	1	aromatic ether; naphthalenes; organobromine compound; quinolines; tertiary alcohol; tertiary amino compound	antitubercular agent; ATP synthase inhibitor
artocarpin lectin artocarpin lectin: a mannose-specific lectin; from the seeds of Artocarpus integrifolia; a homotetramic protein distinct from jacalin, another jackfruit lectin; MW 65 kDa; devoid of covalently-attached carbohydrates; consists of 4 isolectins with pI 5 - 6.5; do not confuse with artocarpin flavone. artocarpin : A trihydroxyflavone that is flavone substituted by hydroxy groups at positions 5, 2', and 4', a methoxy group at position 7, a prenyl group at position 3 and a (1E)-3-methylbut-1-enyl group at position 6. Isolated from Artocarpus heterophyllus and Artocarpus integrifolia, it exhibits antineoplastic activity.	2.41	1	monomethoxyflavone; trihydroxyflavone	antineoplastic agent; metabolite
ceftazidime [no description available]	3.13	4	cephalosporin; oxime O-ether	antibacterial drug; drug allergen; EC 2.4.1.129 (peptidoglycan glycosyltransferase) inhibitor
cefotaxime Cefotaxime: Semisynthetic broad-spectrum cephalosporin.. cefotaxime : A cephalosporin compound having acetoxymethyl and [2-(2-amino-1,3-thiazol-4-yl)-2-(methoxyimino)acetyl]amino side groups.	2.88	3	1,3-thiazoles; cephalosporin; oxime O-ether	antibacterial drug; drug allergen
citreoviridin citreoviridin: formed from Penicillium toxicarium, Penicillium citeoviride; Penicillium ochrosalmoneum on rice during storage	3.31	1	2-pyranones
kla peptide KLA peptide: a synthetic amphipathic peptide that disrupts mitochondrial membranes when internalized; has antineoplastic activity	1.99	1
gentamicin sulfate [no description available]	2.54	2
anoplin anoplin: an antimicrobial peptide from the venom of the solitary wasp Anoplius samariensis; peptide sequence in first source	2.31	1
baci-im [no description available]	2.31	1	homodetic cyclic peptide; polypeptide; zwitterion	antibacterial agent; antimicrobial agent
polymyxin b(1) [no description available]	3.75	8
protegrin-1 protegrin-1: GenBank X84094	2.41	1
ly-146032 [no description available]	2.15	1	heterodetic cyclic peptide; lipopeptide antibiotic; lipopeptide; macrocycle; macrolide	antibacterial drug; bacterial metabolite; calcium-dependent antibiotics
ropocamptide ropocamptide: from granulocytes & keratinocytes, precursor to cathelicidins; MW 16-18 kDa; GenBank AJ224927 (eCATH-1). cathelicidin : A group of small, cationic polypeptides (consisting of 12-97 amino acids) that are found in humans and other species, including farm animals (E.g. cattle, horses, pigs, sheep etc). They show a broad spectrum of antimicrobial activity against bacteria, enveloped viruses and fungi.	3.26	5
ceragenin csa-13 ceragenin CSA-13: has antibacterial activity; isolated from Staphylococcus aureus; structure in first source	2.05	1
bms-790052 daclatasvir: an HCV NS5A inhibitor. daclatasvir : A member of the class of biphenyls that is a potent inhibitor of nonstructural protein 5A and is used (as its hydrochloride salt) for treatment of hepatitis C.	3.51	1	biphenyls; carbamate ester; carboxamide; imidazoles; valine derivative	antiviral drug; nonstructural protein 5A inhibitor
6,8-dihydroxy-2,2,4,4-tetramethyl-7-(3-methylbutanoyl)-9-(2-methylpropyl)-9h-xanthene-1,3-dione [no description available]	2.17	1	xanthenes
halocidin halocidin: antimicrobial peptide from hemocytes of the solitary tunicate, Halocynthia	2.03	1
kalata b1 kalata B1: a 29-residue cyclotide which has a cystine knot structure and beta-sheet; causes uterine contraction; the principal active component from Oldenlandia affinis; amino acid sequence given in first source	2.74	3
tetracycline Tetracycline: A naphthacene antibiotic that inhibits AMINO ACYL TRNA binding during protein synthesis.. tetracycline : A broad-spectrum polyketide antibiotic produced by the Streptomyces genus of actinobacteria.	2.41	1
minocycline Minocycline: A TETRACYCLINE analog, having a 7-dimethylamino and lacking the 5 methyl and hydroxyl groups, which is effective against tetracycline-resistant STAPHYLOCOCCUS infections.. minocycline : A tetracycline analogue having a dimethylamino group at position 7 and lacking the methyl and hydroxy groups at position 5.	2.69	2
salicylates Salicylates: The salts or esters of salicylic acids, or salicylate esters of an organic acid. Some of these have analgesic, antipyretic, and anti-inflammatory activities by inhibiting prostaglandin synthesis.. hydroxybenzoate : Any benzoate derivative carrying a single carboxylate group and at least one hydroxy substituent.. salicylates : Any salt or ester arising from reaction of the carboxy group of salicylic acid, or any ester resulting from the condensation of the phenolic hydroxy group of salicylic acid with an organic acid.. salicylate : A monohydroxybenzoate that is the conjugate base of salicylic acid.	2.63	3	monohydroxybenzoate	plant metabolite
cycloviolacin o2 [no description available]	2.17	1
rifampin Rifampin: A semisynthetic antibiotic produced from Streptomyces mediterranei. It has a broad antibacterial spectrum, including activity against several forms of Mycobacterium. In susceptible organisms it inhibits DNA-dependent RNA polymerase activity by forming a stable complex with the enzyme. It thus suppresses the initiation of RNA synthesis. Rifampin is bactericidal, and acts on both intracellular and extracellular organisms. (From Gilman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 9th ed, p1160)	3.53	6	cyclic ketal; hydrazone; N-iminopiperazine; N-methylpiperazine; rifamycins; semisynthetic derivative; zwitterion	angiogenesis inhibitor; antiamoebic agent; antineoplastic agent; antitubercular agent; DNA synthesis inhibitor; EC 2.7.7.6 (RNA polymerase) inhibitor; Escherichia coli metabolite; geroprotector; leprostatic drug; neuroprotective agent; pregnane X receptor agonist; protein synthesis inhibitor

Condition	Relationship Strength	Studies
Extravascular Hemolysis [description not available]	5.3	19
Hemolysis The destruction of ERYTHROCYTES by many different causal agents such as antibodies, bacteria, chemicals, temperature, and changes in tonicity.	5.3	19
Disease Models, Animal Naturally-occurring or experimentally-induced animal diseases with pathological processes analogous to human diseases.	2.03	1
Infections, Listeria [description not available]	2.03	1
Angiogenesis, Pathologic [description not available]	2.04	1
Endotoxin Shock [description not available]	2.05	1
Shock, Septic Sepsis associated with HYPOTENSION or hypoperfusion despite adequate fluid resuscitation. Perfusion abnormalities may include but are not limited to LACTIC ACIDOSIS; OLIGURIA; or acute alteration in mental status.	2.05	1
Aspergilloses, Bronchopulmonary [description not available]	2.07	1
Pulmonary Aspergillosis Infections of the respiratory tract with fungi of the genus ASPERGILLUS.	2.07	1
Cancer of Colon [description not available]	2.07	1
Colonic Neoplasms Tumors or cancer of the COLON.	2.07	1
Benign Neoplasms [description not available]	2.1	1
Neoplasms New abnormal growth of tissue. Malignant neoplasms show a greater degree of anaplasia and have the properties of invasion and metastasis, compared to benign neoplasms.	2.1	1
Bacterial Disease [description not available]	2.86	3
Infections, Staphylococcal [description not available]	2.68	3
Bacterial Infections Infections by bacteria, general or unspecified.	2.86	3
Staphylococcal Infections Infections with bacteria of the genus STAPHYLOCOCCUS.	2.68	3
Infections, Pseudomonas [description not available]	2.61	2
Pseudomonas Infections Infections with bacteria of the genus PSEUDOMONAS.	2.61	2
Co-infection [description not available]	2.21	1
Eye Infections, Fungal Infection by a variety of fungi, usually through four possible mechanisms: superficial infection producing conjunctivitis, keratitis, or lacrimal obstruction; extension of infection from neighboring structures - skin, paranasal sinuses, nasopharynx; direct introduction during surgery or accidental penetrating trauma; or via the blood or lymphatic routes in patients with underlying mycoses.	2.21	1
Keratitis Inflammation of the cornea.	2.63	2
Bacterial Eye Infections [description not available]	2.25	1
Breast Cancer [description not available]	2.25	1
Breast Neoplasms Tumors or cancer of the human BREAST.	2.25	1
Bacterial Pneumonia [description not available]	2.31	1
Pneumonia, Bacterial Inflammation of the lung parenchyma that is caused by bacterial infections.	2.31	1
Abscess Accumulation of purulent material in tissues, organs, or circumscribed spaces, usually associated with signs of infection.	2.41	1
Rheumatism [description not available]	6.93	1
Rheumatic Diseases Disorders of connective tissue, especially the joints and related structures, characterized by inflammation, degeneration, or metabolic derangement.	1.93	1
Polyarthritis [description not available]	1.96	1
Idiopathic Inflammatory Myopathies [description not available]	1.96	1
Arthritis Acute or chronic inflammation of JOINTS.	1.96	1
Myositis Inflammation of a muscle or muscle tissue.	1.96	1

forapin

Description

Cross-References

Synonyms (29)

Research Excerpts

Bioavailability

Roles (7)

Drug Classes (2)

Pathways (1)

Protein Targets (3)

Potency Measurements

Bioassays (849)

Research

Studies (68)

Market Indicators

Research Demand Index: 23.01

Study Types

forapin

Description

Cross-References

Synonyms (29)

Research Excerpts

Bioavailability

Roles (7)

Drug Classes (2)

Pathways (1)

Protein Targets (3)

Potency Measurements

Bioassays (849)

Research

Studies (68)

Market Indicators

Research Demand Index: 23.01

Study Types

Related Drugs (91)

Related Conditions (34)