Compounds > ropocamptide
Page last updated: 2024-11-12

ropocamptide

Description Research Excerpts Clinical Trials Roles Classes Pathways Study Profile Bioassays Related Drugs Related Conditions Protein Interactions Research Growth

Description

ropocamptide: from granulocytes & keratinocytes, precursor to cathelicidins; MW 16-18 kDa; GenBank AJ224927 (eCATH-1) [Medical Subject Headings (MeSH), National Library of Medicine, extracted Dec-2023]

cathelicidin : A group of small, cationic polypeptides (consisting of 12-97 amino acids) that are found in humans and other species, including farm animals (E.g. cattle, horses, pigs, sheep etc). They show a broad spectrum of antimicrobial activity against bacteria, enveloped viruses and fungi. [Chemical Entities of Biological Interest (ChEBI), Hastings J, Owen G, Dekker A, Ennis M, Kale N, Muthukrishnan V, Turner S, Swainston N, Mendes P, Steinbeck C. (2016). ChEBI in 2016: Improved services and an expanding collection of metabolites. Nucleic Acids Res]

Cross-References

ID SourceID
PubMed CID16198951
CHEMBL ID530345
MeSH IDM0192257

Synonyms (22)

Synonym
bac4
ropocamptide
ll-37/hcap18
ll-37
nh2-leu-leu-gly-asp-phe-phe-arg-lys-ser-lys-glu-lys-ile-gly-lys-glu-phe-lys-arg-ile-val-gln-arg-ile-lys-asp-phe-leu-arg-asn-leu-val-pro-arg-thr-glu-ser-cooh
CHEMBL530345
cathelicidin
cap-18
RS-2000
ll-37 (llgdffrkskekigkefkrivqrikdflrnlvprtes-acid)
154947-66-7
llgdffrkskekigkefkrivqrikdflrnlvprtes
ll 37 ,
AKOS024458536
EX-A7429A
ll-37(human)
all38 peptide
cathelicidin antimicrobial peptide 18 ,
cap18,
ll-37 (human)
cathelicidin ll 37
hcap 18
[information is derived through text-mining from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Bioassays (219)

Assay IDTitleYearJournalArticle
AID1609410Fractional inhibitory concentration, ratio of MIC of compound in presence of oxacillin to MIC of compound for antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 20952019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741166Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as fractional inhibitory concentration incubated for 24 hrs in presence of oxacillin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID534318Antimicrobial activity against mega::aad9-positive Streptococcus pneumoniae XZ8006 by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1609397Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 72 hrs in presence of 1024 uM ciprofloxacin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID534531Antimicrobial activity against Escherichia coli KCTC 1039 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1809127Antimicrobial activity against Salmonella enterica assessed as bacterial growth inhibition incubated in presence of serum for 24 hrs2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1609359Antibacterial activity against vancomycin-resistant Enterococcus faecium ATCC 51559 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID396232Bactericidal activity against Haemophilus ducreyi CIP542 assessed as survival at 20 ug/ml by antibacterial susceptibility test relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID1609404Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth at 8 uM incubated for 72 hrs in presence of oxacillin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741175Induction of cell membrane permeability in Escherichia coli KCTC 1682 assessed as cytoplasmic membrane depolarization at 2 times MIC by ONPG dye based spectrophotometry2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID544265Stability of the compound at 136 uM after 4 hrs in presence of human neutrophil elastase2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID530286Antimicrobial activity against PR-39-resistant Salmonella enterica serovar Typhimurium LT2 DA10899 harboring Q179Stop mutant gene by Etest2008Antimicrobial agents and chemotherapy, Aug, Volume: 52, Issue:8
Mechanism and fitness costs of PR-39 resistance in Salmonella enterica serovar Typhimurium LT2.
AID1609413Fractional inhibitory concentration, ratio of MIC of compound in presence of 512 uM oxacillin to MIC of oxacillin for antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 30892019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID396221Bactericidal activity against Haemophilus ducreyi 35000HP assessed as survival at 2 ug/ml by tenfold serial dilution assay relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID1286801Antibacterial activity against Staphylococcus aureus Newman incubated for 20 hrs by microplate reader analysis2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID559324Antimicrobial activity against Salmonella enterica serovar Typhimurium LT2 DA10845 harboring pmrB (ATG to ATA, M186I mutant) grown in liquid culture2009Antimicrobial agents and chemotherapy, Jun, Volume: 53, Issue:6
Genetic analysis of colistin resistance in Salmonella enterica serovar Typhimurium.
AID351103Therapeutic index, ratio of MHC for RBC to MIC for Bacillus subtilis ATCC 60512009Bioorganic & medicinal chemistry, May-01, Volume: 17, Issue:9
A series of cationic sterol lipids with gene transfer and bactericidal activity.
AID1741139Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 4.5 mM KCl by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609357Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1809126Antimicrobial activity against Pseudomonas sp assessed as bacterial growth inhibition incubated in presence of serum for 24 hrs2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1286796Antibacterial activity against Staphylococcus aureus clinical isolate USA200 incubated for 20 hrs by microplate reader analysis2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID534319Antimicrobial activity against mega::aad9-positive Streptococcus pneumoniae XZ8006 expressing PmefE-lacZ gene induced by pretreatment with 50 ug/ml of compound for 1 hr by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1609406Fractional inhibitory concentration, ratio of MIC of compound in presence of 512 uM ciprofloxacin to MIC of ciprofloxacin for antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 20952019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1609398Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 72 hrs in presence of 512 uM oxacillin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID498874Antimicrobial activity against Neisseria meningitidis M7tolC::Kan by agar dilution method2010Antimicrobial agents and chemotherapy, Jan, Volume: 54, Issue:1
Biologic activities of the TolC-like protein of Neisseria meningitidis as assessed by functional complementation in Escherichia coli.
AID1741164Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as fractional inhibitory concentration incubated for 24 hrs in presence of chloramphenicol by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID534544Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3696 by radial diffusion assay incubated with Pseudomonas aeruginosa Culture supernatant for 1 hr2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1741152Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 24 hrs in presence of chloramphenicol by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID534322Antimicrobial activity against mefE-mel::aph3-positive Streptococcus pneumoniae XZ8009 expressing PmefE-lacZ gene induced by pretreatment with 50 ug/ml of compound for 1 hr by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID534329Antimicrobial activity against mega::aad9-positive Streptococcus pneumoniae XZ8004 by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID559321Antimicrobial activity against Salmonella enterica serovar Typhimurium LT2 DA10826 harboring pmrA (GGG to GAG, G53E mutant) grown in liquid culture2009Antimicrobial agents and chemotherapy, Jun, Volume: 53, Issue:6
Genetic analysis of colistin resistance in Salmonella enterica serovar Typhimurium.
AID534528Antimicrobial activity against vancomycin-resistant Enterococcus faecium CCARM 5028 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID396225Bactericidal activity against Haemophilus ducreyi 35000HP assessed as survival at 0.2 ug/ml by antibacterial susceptibility test relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID534325Antimicrobial activity against Streptococcus pneumoniae XZ7042 expressing PmefE-lacZ gene induced by pretreatment with 200 ug/ml of compound for 1 hr by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1433373Therapeutic index, ratio of MHC for sheep RBC to MIC for Escherichia coli KCTC 16822017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1609412Fractional inhibitory concentration, ratio of MIC of compound in presence of 1024 uM ciprofloxacin to MIC of ciprofloxacin for antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 30892019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1054907Activation of NFkappaB p65 in mouse BMDM assessed as phosphorylation at 10 ug/ml after 15 to 30 mins by Western blotting2013Journal of medicinal chemistry, Nov-27, Volume: 56, Issue:22
Naturally occurring antimicrobial peptide OH-CATH30 selectively regulates the innate immune response to protect against sepsis.
AID543561Antimicrobial activity against Staphylococcus aureus 2844 after 21 hrs by broth microdilution method2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID534334Antimicrobial activity against mefE-mel::aph3-positive Streptococcus pneumoniae XZ8009 by Etest method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID396223Bactericidal activity against Haemophilus ducreyi 35000HP assessed as survival at 0.5 ug/ml by twofold serial dilution assay relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID1433396Induction of inner membrane permeabilisation in Escherichia coli ML-35 assessed as ONPG hydrolysis up to 30 ug/ml by beta-galactosidase enzyme coupled spectrophotometric analysis2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1609354Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1609415Fractional inhibitory concentration, ratio of MIC of compound in presence of ciprofloxacin to MIC of ciprofloxacin for antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 30892019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID762052Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID534330Antimicrobial activity against mega::aad9-positive Streptococcus pneumoniae XZ8004 expressing PmefE-lacZ gene induced by pretreatment with 100 ug/ml of compound for 1 hr by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1433394Antibiofilm activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 after 24 hrs by crystal violet staining based method2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1741156Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as fractional inhibitory concentration incubated for 24 hrs in presence of ciprofloxacin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1286816Antibiofilm activity against Staphylococcus aureus Mu50 assessed as 24 hr preformed biofilm disruption at 3.1 to 25 uM incubated for 24 hrs by XTT assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1609414Fractional inhibitory concentration, ratio of MIC of compound in presence of chloramphenicol to MIC of chloramphenicol for antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 30892019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1609405Fractional inhibitory concentration, ratio of MIC of compound in presence of 1024 uM chloramphenicol to MIC of chloramphenicol for antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 20952019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID534315Antimicrobial activity against wild-type Streptococcus pneumoniae GA17457 expressing PmefE-lacZ gene induced by pretreatment with 1 ug/ml of erythromycin for 1 hr by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID544268Stability of the compound at 136 uM after 4 hrs in presence of human V8 protease2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID1433370Antimicrobial activity against Pseudomonas aeruginosa KCTC 1637 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID534314Antimicrobial activity against wild-type Streptococcus pneumoniae GA17457 expressing PmefE-lacZ gene induced by pretreatment with 200 ug/ml of compound for 1 hr by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID532240Induction of CFP-tagged glucocorticoid receptor nuclear localization expressed in BAEC at 0.01 to 1 uM after 1 hr by luminescence assay2010Antimicrobial agents and chemotherapy, Jun, Volume: 54, Issue:6
Combined antibacterial and anti-inflammatory activity of a cationic disubstituted dexamethasone-spermine conjugate.
AID534530Antimicrobial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2161 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1741154Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 24 hrs in presence of oxacillin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609349Antiinflammatory activity in mouse RAW264.7 cells assessed as reduction in LPS-induced iNOS gene expression at 4 uM incubated for 3 hrs by qRT-PCR analysis2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741159Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as fractional inhibitory concentration index incubated for 24 hrs in presence of ciprofloxacin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID762055Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID1609431Induction of membrane integrity disruption in Escherichia coli at 2 times of MIC by propidium iodide staining based flow cytometry relative to control (Rvb = 2.97 %)2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1286797Antibacterial activity against Staphylococcus aureus clinical isolate USA300 incubated for 20 hrs by microplate reader analysis2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID396228Bactericidal activity against Escherichia coli ML35 after 48 to 72 hrs by radial diffusion assay2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID534532Antimicrobial activity against Klebsiella oxytoca KCTC 1686 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1741149Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 2.5 mM CaCl2 by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID498876Antimicrobial activity against Neisseria meningitidis M7tolC::Kan mtr::Spc by agar dilution method2010Antimicrobial agents and chemotherapy, Jan, Volume: 54, Issue:1
Biologic activities of the TolC-like protein of Neisseria meningitidis as assessed by functional complementation in Escherichia coli.
AID1609419Fractional inhibitory concentration index, sum of ratio of MIC of compound in presence of 512 uM oxacillin to MIC of chloramphenicol and ratio of MIC of compound in presence of oxacillin to MIC of compound for antibacterial activity against multidrug-resi2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1609428Potentiation of oxacillin-induced antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in oxacillin MIC at 1/16th MIC incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1286815Antibiofilm activity against Staphylococcus aureus clinical isolate USA400 assessed as 24 hr preformed biofilm disruption at 3.1 to 25 uM incubated for 24 hrs by XTT assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID534537Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3696 by colony count assay incubated with trypsin for 1 hr2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1741151Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 20 % serum by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID396233Bactericidal activity against Haemophilus ducreyi CIP542 after 48 to 72 hrs by radial diffusion assay2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID534529Antimicrobial activity against Listeria monocytogenes KCTC 19111 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID534321Antimicrobial activity against mefE-mel::aph3-positive Streptococcus pneumoniae XZ8009 by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1741174Induction of cell membrane permeability in Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by SYTOX dye based fluorescence assay2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609427Potentiation of ciprofloxacin-induced antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in ciprofloxacin MIC at 1/16th MIC incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID521239Antibacterial activity against Streptococcus mutans ATCC 27351 assessed as growth inhibition at 100 ug/ml following preincubation of compound with supernatant of Aggregatibacter actinomycetemcommitans ATCC 295232008Antimicrobial agents and chemotherapy, Feb, Volume: 52, Issue:2
Resistance of Porphyromonas gingivalis ATCC 33277 to direct killing by antimicrobial peptides is protease independent.
AID534313Antimicrobial activity against wild-type Streptococcus pneumoniae GA17457 by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID396229Bactericidal activity against Haemophilus ducreyi 35000HP after 48 to 72 hrs by radial diffusion assay2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID534324Antimicrobial activity against Streptococcus pneumoniae XZ7042 by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID559323Antimicrobial activity against Salmonella enterica serovar Typhimurium LT2 DA10840 harboring pmrA (CGC to CAC, R81H mutant) grown in liquid culture2009Antimicrobial agents and chemotherapy, Jun, Volume: 53, Issue:6
Genetic analysis of colistin resistance in Salmonella enterica serovar Typhimurium.
AID1609409Fractional inhibitory concentration, ratio of MIC of compound in presence of ciprofloxacin to MIC of compound for antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 20952019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1809130Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1609396Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 72 hrs in presence of 128 uM chloramphenicol by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID543564Antimicrobial activity against Pseudomonas aeruginosa 15159 after 21 hrs by broth microdilution method2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID1286818Antibiofilm activity against Staphylococcus aureus clinical isolate UAMS-1 assessed as 24 hr preformed biofilm disruption at 3.1 to 25 uM incubated for 24 hrs by XTT assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1741153Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 24 hrs in presence of ciprofloxacin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1741179Induction of cell membrane permeability in Escherichia coli KCTC 1682 assessed as cytoplasmic membrane depolarization by measuring PI fluorescent signals at 2 times MIC measured after 1 hr by propidium iodide dye based flow cytometry analysis (Rvb = 9.8 %2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609400Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth at 8 uM incubated for 72 hrs in presence of chloramphenicol by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741147Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 6 uM NH4Cl by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1741146Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 4.5 mM KCl by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID396222Bactericidal activity against Escherichia coli ML35 assessed as survival at 2 ug/ml by tenfold serial dilution assay relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID762056Antibacterial activity against Staphylococcus epidermidis KCTC 1917 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID1809141Induction of membrane depolarization in Escherichia coli at 0.4 uM incubated 20 to 30 mins under dark by Eclipse fluorescence spectrometry2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1609418Fractional inhibitory concentration index, sum of ratio of MIC of compound in presence of 512 uM ciprofloxacin to MIC of chloramphenicol and ratio of MIC of compound in presence of ciprofloxacin to MIC of compound for antibacterial activity against multid2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1809124Antimicrobial activity against Escherichia coli assessed as bacterial growth inhibition incubated in presence of serum for 24 hrs2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1609420Fractional inhibitory concentration index, sum of ratio of MIC of compound in presence of 128 uM chloramphenicol to MIC of chloramphenicol and ratio of MIC of compound in presence of chloramphenicol to MIC of chloramphenicol for antibacterial activity aga2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741157Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as fractional inhibitory concentration incubated for 24 hrs in presence of oxacillin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609426Potentiation of oxacillin-induced antibacterial activity against mutidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in oxacillin MIC at 1/16th MIC incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741161Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 24 hrs in presence of chloramphenicol by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1286814Antibiofilm activity against Staphylococcus aureus clinical isolate USA200 assessed as 24 hr preformed biofilm disruption at 3.1 to 25 uM incubated for 24 hrs by XTT assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1741162Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 24 hrs in presence of ciprofloxacin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609416Fractional inhibitory concentration, ratio of MIC of compound in presence of oxacillin to MIC of oxacillin for antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 30892019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1609424Potentiation of chloramphenicol-induced antibacterial activity against mutidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in chloramphenicol MIC at 1/16th MIC incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID396230Bactericidal activity against Haemophilus ducreyi CIP542 assessed as survival at 0.2 ug/ml by antibacterial susceptibility test relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID1609417Fractional inhibitory concentration index, sum of ratio of MIC of compound in presence of 1024 uM chloramphenicol to MIC of chloramphenicol and ratio of MIC of compound in presence of chloramphenicol to MIC of compound for antibacterial activity against m2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1609402Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth at 8 uM incubated for 72 hrs in presence of ciprofloxacin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID534332Antimicrobial activity against wild-type Streptococcus pneumoniae GA17457 by Etest method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1609392Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth at 4 uM incubated for 72 hrs in presence of ciprofloxacin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID544266Stability of the compound at 136 uM after 4 hrs in presence of Pseudomonas aeruginosa elastase2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID534545Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3696 by radial diffusion assay incubated with Staphylococcus aureus Culture supernatant for 1 hr2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID543563Antimicrobial activity against Pseudomonas aeruginosa ATCC 27853 after 21 hrs by broth microdilution method2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID1741158Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as fractional inhibitory concentration index incubated for 24 hrs in presence of chloramphenicol by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1741186Inhibition of Escherichia coli O111:B4 LPS aggregation assessed as increase in FITC-LPS dissociation by spectrofluorometry2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID543552Antimicrobial activity against Staphylococcus aureus FDA 486 after 21 hrs by broth microdilution method2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID762047Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as obvious disruption of cellular structure at 10 X MIC after 1 hr by transmission electron microscopic analysis2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID1609429Induction of cytoplasmic membrane depolarization in Staphylococcus aureus at 2 times of MIC for a period of 600 sec by DiSC3-5-fluorescence based assay2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741167Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as fractional inhibitory concentration index incubated for 24 hrs in presence of chloramphenicol by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID351104Therapeutic index, ratio of MHC for RBC to MIC for Escherichia coli MG16552009Bioorganic & medicinal chemistry, May-01, Volume: 17, Issue:9
A series of cationic sterol lipids with gene transfer and bactericidal activity.
AID1741136Antiinflammatory activity against mouse RAW264.7 cells assessed as reduction in LPS-induced iNOS mRNA expression at 5 uM incubated for 6 hrs by qRT-PCR analysis2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID498873Antimicrobial activity against Neisseria meningitidis M7 by agar dilution method2010Antimicrobial agents and chemotherapy, Jan, Volume: 54, Issue:1
Biologic activities of the TolC-like protein of Neisseria meningitidis as assessed by functional complementation in Escherichia coli.
AID1741155Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as fractional inhibitory concentration incubated for 24 hrs in presence of chloramphenicol by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1286805Inhibition of biofilm formation in Staphylococcus aureus clinical isolate USA300 at 6.2 to 25 uM incubated for 24 hrs by XTT/PMS assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID559320Antimicrobial activity against Salmonella enterica serovar Typhimurium LT2 DA6192 grown in liquid culture2009Antimicrobial agents and chemotherapy, Jun, Volume: 53, Issue:6
Genetic analysis of colistin resistance in Salmonella enterica serovar Typhimurium.
AID1741145Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 150 mM NaCl by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID351100Antibacterial activity against Bacillus subtilis ATCC 6051 after 20 hrs2009Bioorganic & medicinal chemistry, May-01, Volume: 17, Issue:9
A series of cationic sterol lipids with gene transfer and bactericidal activity.
AID534335Antimicrobial activity against Streptococcus pneumoniae XZ7042 by Etest method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1609386Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 72 hrs in presence of 1024 uM chloramphenicol by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741163Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 24 hrs in presence of oxacillin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID521097Antibacterial activity against protease deficient Porphyromonas gingivalis KDP1362008Antimicrobial agents and chemotherapy, Feb, Volume: 52, Issue:2
Resistance of Porphyromonas gingivalis ATCC 33277 to direct killing by antimicrobial peptides is protease independent.
AID351102Toxicity against RBC assessed as hemolytic activity2009Bioorganic & medicinal chemistry, May-01, Volume: 17, Issue:9
A series of cationic sterol lipids with gene transfer and bactericidal activity.
AID1809142Induction of membrane damage in Escherichia coli assessed as loss of membrane integrity by measuring blebs at 10 uM incubated for 2 hrs by Electron scanning microscopy2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1609422Fractional inhibitory concentration index, sum of ratio of MIC of compound in presence of 512 uM oxacillin to MIC of oxacillin and ratio of MIC of compound in presence of oxacillin to MIC of oxacillin for antibacterial activity against methicillin-resista2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID534543Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3696 by radial diffusion assay incubated with matrix metalloprotease 7 for 5 mins2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1741190Antiinflammatory activity in mouse RAW264.7 cells assessed as neutralization of LPS binding by measuring LPS-FITC aggregation at 10 uM pretreated with LPS for 1 hr followed by compound addition and measured after 1 hr by flowcytometry analysis (Rvb = 48.12020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609395Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in bacterial growth incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1286798Antibacterial activity against Staphylococcus aureus clinical isolate USA400 incubated for 20 hrs by microplate reader analysis2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1609425Potentiation of ciprofloxacin-induced antibacterial activity against mutidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in ciprofloxacin MIC at 1/16th MIC incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID530287Antimicrobial activity against PR-39-resistant sbmA-deficient Salmonella enterica serovar Typhimurium LT2 DA12088 by Etest2008Antimicrobial agents and chemotherapy, Aug, Volume: 52, Issue:8
Mechanism and fitness costs of PR-39 resistance in Salmonella enterica serovar Typhimurium LT2.
AID1741168Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as fractional inhibitory concentration index incubated for 24 hrs in presence of ciprofloxacin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609333Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741143Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 4 uM FeCl3 by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID534326Antimicrobial activity against Streptococcus pneumoniae XZ7042 expressing PmefE-lacZ gene induced by pretreatment with 1 ug/ml of erythromycin for 1 hr by microdilution method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1741148Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 1 mM MgCl2 by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609356Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID534535Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3696 by colony count assay incubated with trypsin for 10 mins2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1433369Antimicrobial activity against Escherichia coli KCTC 1682 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1609430Induction of cytoplasmic membrane depolarization in Staphylococcus aureus at 2 times of MIC within 4 mins by SYTOX green-based assay2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741160Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as fractional inhibitory concentration index incubated for 24 hrs in presence of oxacillin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1286800Antibacterial activity against Staphylococcus aureus clinical isolate UAMS-1 incubated for 20 hrs by microplate reader analysis2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1286813Antibiofilm activity against Staphylococcus aureus clinical isolate USA300 assessed as 24 hr preformed biofilm disruption at 3.1 to 25 uM incubated for 24 hrs by XTT assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID521234Antibacterial activity against Streptococcus mutans ATCC 27351 assessed as growth inhibition at 100 ug/ml following preincubation of compound with supernatant of Porphyromonas gingivalis ATCC 332772008Antimicrobial agents and chemotherapy, Feb, Volume: 52, Issue:2
Resistance of Porphyromonas gingivalis ATCC 33277 to direct killing by antimicrobial peptides is protease independent.
AID1433376Therapeutic index, ratio of MHC for sheep RBC to MIC for Staphylococcus epidermidis KCTC 19172017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1809129Hemolytic activity in horse RBC assessed as hemolysis at 250 uM relative to control2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1433374Therapeutic index, ratio of MHC for sheep RBC to MIC for Pseudomonas aeruginosa KCTC 16372017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1741140Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 6 uM NH4Cl by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1609423Potentiation of chloramphenicol-induced antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as reduction in chloramphenicol MIC at 1/16th MIC incubated for 72 hrs by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID762053Hemolytic activity in human RBC after 1 hr2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID1741169Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as fractional inhibitory concentration index incubated for 24 hrs in presence of oxacillin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID762048Antibacterial activity against Escherichia coli KCTC 1682 assessed as obvious disruption of cellular structure at 10 X MIC after 1 hr by transmission electron microscopic analysis2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID1741184Displacement of BODIPY-TR cadaverine from Escherichia coli O111:B4 LPS at 10 uM measured for 100 sec by spectrofluorometry relative to control2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1347558Antibiofilm activity against drug-resistant pre-formed Staphylococcus aureus biofilms assessed as inhibition of biomass formation at 4 times MIC2018European journal of medicinal chemistry, Jan-01, Volume: 143Design and synthesis of short amphiphilic cationic peptidomimetics based on biphenyl backbone as antibacterial agents.
AID1609350Antiinflammatory activity in mouse RAW264.7 cells assessed as reduction in LPS-induced TNFalpha gene expression at 8 uM incubated for 6 hrs by qRT-PCR analysis2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID521240Antibacterial activity against Escherichia coli ATCC 25922 assessed as growth inhibition at 100 ug/ml following preincubation of compound with supernatant of Aggregatibacter actinomycetemcommitans ATCC 295232008Antimicrobial agents and chemotherapy, Feb, Volume: 52, Issue:2
Resistance of Porphyromonas gingivalis ATCC 33277 to direct killing by antimicrobial peptides is protease independent.
AID1286804Inhibition of biofilm formation in Staphylococcus aureus clinical isolate USA300 at 3.1 uM incubated for 24 hrs by XTT/PMS assay relative to control2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1741173Induction of cell membrane permeability in Staphylococcus aureus KCTC 1621 assessed as cytoplasmic membrane depolarization at 2 times MIC by DiSC3-5 dye based spectrofluorometry2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1809125Antimicrobial activity against Acinetobacter baumannii assessed as bacterial growth inhibition incubated in presence of serum for 24 hrs2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1286817Antibiofilm activity against Staphylococcus aureus Newman assessed as 24 hr preformed biofilm disruption at 3.1 to 25 uM incubated for 24 hrs by XTT assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1609358Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2109 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID762057Antibacterial activity against Pseudomonas aeruginosa KCTC 1637 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID396227Bactericidal activity against Haemophilus ducreyi 35000HP assessed as survival at 20 ug/ml by antibacterial susceptibility test relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID1741189Antiinflammatory activity in mouse RAW264.7 cells assessed as suppression of LPS binding by measuring LPS-FITC aggregation at 10 uM pretreated with LPS for 1 hr followed by compound addition and measured after 30 mins by flowcytometry analysis (Rvb = 67.92020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID534527Antimicrobial activity against Micrococcus luteus KCTC 9341 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID498875Antimicrobial activity against Neisseria meningitidis M7mtrE::Spc by agar dilution method2010Antimicrobial agents and chemotherapy, Jan, Volume: 54, Issue:1
Biologic activities of the TolC-like protein of Neisseria meningitidis as assessed by functional complementation in Escherichia coli.
AID1415097Induction of membrane permeabilization in Escherichia coli KCTC 1682 assessed as PI-positive cells at 16 uM after 1 to 2 hrs by propidium iodide-staining based flow cytometry (Rvb = 2.36%)2018Journal of medicinal chemistry, 12-27, Volume: 61, Issue:24
Structural and Functional Assessment of mBjAMP1, an Antimicrobial Peptide from Branchiostoma japonicum, Revealed a Novel α-Hairpinin-like Scaffold with Membrane Permeable and DNA Binding Activity.
AID1809128Antimicrobial activity against Shigella flexneri assessed as bacterial growth inhibition incubated in presence of serum for 24 hrs2021Journal of medicinal chemistry, 08-12, Volume: 64, Issue:15
Rationally Modified Antimicrobial Peptides from the N-Terminal Domain of Human RNase 3 Show Exceptional Serum Stability.
AID1609390Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth at 4 uM incubated for 72 hrs in presence of chloramphenicol by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741141Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 1 mM MgCl2 by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID534336Antimicrobial activity against mega::aad9-positive Streptococcus pneumoniae XZ8004 by Etest method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1609394Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth at 4 uM incubated for 72 hrs in presence of oxacillin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID762051Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3095 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID534526Antimicrobial activity against Bacillus subtilis KCTC 2213 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1609355Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3090 assessed as reduction in bacterial growth incubated for 18 hrs by spectrophotometry based microtiter broth dilution method2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID534525Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3696 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1609407Fractional inhibitory concentration, ratio of MIC of compound in presence of 512 uM oxacillin to MIC of oxacillin for antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 20952019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID762054Antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 3089 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
AID544267Stability of the compound at 136 uM after 4 hrs in presence of aureolysin2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID534533Antimicrobial activity against Citrobacter freundii KCTC 2359 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1609421Fractional inhibitory concentration index, sum of ratio of MIC of compound in presence of 1024 uM ciprofloxacin to MIC of ciprofloxacin and ratio of MIC of compound in presence of ciprofloxacin to MIC of ciprofloxacin for antibacterial activity against me2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1286803Antibiofilm activity against Staphylococcus aureus clinical isolate USA300 assessed as inhibition of bacterial attachment at 3.1 to 25 uM incubated for 1 hr by XTT/PMS assay2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1741150Antibacterial activity against Staphylococcus aureus KCTC 1621 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 4 uM FeCl3 by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1741142Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 2.5 mM CaCl2 by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID1235886Antimicrobial activity against Escherichia coli ATCC 259222015Journal of natural products, Aug-28, Volume: 78, Issue:8
Isolation, Characterization, and Synthesis of the Barrettides: Disulfide-Containing Peptides from the Marine Sponge Geodia barretti.
AID1609387Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 72 hrs in presence of 512 uM ciprofloxacin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741144Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 20 % serum by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID521099Antibacterial activity against Escherichia coli ATCC 25922 assessed as growth inhibition at 100 ug/ml following preincubation of compound with supernatant of Porphyromonas gingivalis ATCC 332772008Antimicrobial agents and chemotherapy, Feb, Volume: 52, Issue:2
Resistance of Porphyromonas gingivalis ATCC 33277 to direct killing by antimicrobial peptides is protease independent.
AID1609411Fractional inhibitory concentration, ratio of MIC of compound in presence of 128 uM chloramphenicol to MIC of chloramphenicol for antibacterial activity against methicillin-resistant Staphylococcus aureus CCARM 30892019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1433377Therapeutic index, ratio of MHC for sheep RBC to MIC for Staphylococcus aureus KCTC 16212017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1286799Antibacterial activity against Staphylococcus aureus Mu50 incubated for 20 hrs by microplate reader analysis2016ACS medicinal chemistry letters, Jan-14, Volume: 7, Issue:1
Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides.
AID1741137Antiinflammatory activity against mouse RAW264.7 cells assessed as reduction in LPS-induced TNFalpha mRNA expression at 10 uM incubated for 3 hrs by qRT-PCR analysis2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID396226Bactericidal activity against Haemophilus ducreyi 35000HP assessed as survival at 2 ug/ml by antibacterial susceptibility test relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID1433371Antimicrobial activity against Staphylococcus epidermidis KCTC 1917 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID534333Antimicrobial activity against mega::aad9-positive Streptococcus pneumoniae XZ8006 by Etest method2010Antimicrobial agents and chemotherapy, Aug, Volume: 54, Issue:8
Human antimicrobial peptide LL-37 induces MefE/Mel-mediated macrolide resistance in Streptococcus pneumoniae.
AID1235887Antimicrobial activity against Staphylococcus aureus ATCC 292132015Journal of natural products, Aug-28, Volume: 78, Issue:8
Isolation, Characterization, and Synthesis of the Barrettides: Disulfide-Containing Peptides from the Marine Sponge Geodia barretti.
AID1609388Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as reduction in bacterial growth incubated for 72 hrs in presence of 512 uM oxacillin by spectrophotometry2019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID351101Antibacterial activity against Escherichia coli MG1655 after 20 hrs2009Bioorganic & medicinal chemistry, May-01, Volume: 17, Issue:9
A series of cationic sterol lipids with gene transfer and bactericidal activity.
AID534536Antimicrobial activity against methicillin-resistant Staphylococcus aureus CCARM 3696 by colony count assay incubated with trypsin for 20 mins2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID530288Antimicrobial activity against PR-39-resistant Salmonella enterica serovar Typhimurium LT2 DA6192 by Etest2008Antimicrobial agents and chemotherapy, Aug, Volume: 52, Issue:8
Mechanism and fitness costs of PR-39 resistance in Salmonella enterica serovar Typhimurium LT2.
AID1741138Antibacterial activity against Escherichia coli KCTC 1682 assessed as reduction in bacterial growth incubated for 24 hrs in presence of 150 mM NaCl by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID543562Antimicrobial activity against Staphylococcus aureus 29213 after 21 hrs by broth microdilution method2009Antimicrobial agents and chemotherapy, Feb, Volume: 53, Issue:2
Evaluation of strategies for improving proteolytic resistance of antimicrobial peptides by using variants of EFK17, an internal segment of LL-37.
AID559322Antimicrobial activity against Salmonella enterica serovar Typhimurium LT2 DA10833 harboring pmrB (GAA to AAA, E161K mutant) grown in liquid culture2009Antimicrobial agents and chemotherapy, Jun, Volume: 53, Issue:6
Genetic analysis of colistin resistance in Salmonella enterica serovar Typhimurium.
AID1433397Induction of cytoplasmic membrane depolarization in Staphylococcus aureus KCTC 1621 assessed as loss of membrane potential after 1 hr by DiSC3(5) dye based fluorescence assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID1433372Antimicrobial activity against Staphylococcus aureus KCTC 1621 incubated for 18 to 20 hrs by broth microdilution assay2017European journal of medicinal chemistry, Jan-05, Volume: 125Pyrazole derived ultra-short antimicrobial peptidomimetics with potent anti-biofilm activity.
AID534534Antimicrobial activity against Salmonella enterica KCTC 2930 after 18 hrs by broth dilution method2010Antimicrobial agents and chemotherapy, Jul, Volume: 54, Issue:7
Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases.
AID1609408Fractional inhibitory concentration, ratio of MIC of compound in presence of chloramphenicol to MIC of compound for antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 20952019European journal of medicinal chemistry, Nov-15, Volume: 182The design of a cell-selective fowlicidin-1-derived peptide with both antimicrobial and anti-inflammatory activities.
AID1741165Antibacterial activity against multidrug-resistant Pseudomonas aeruginosa CCARM 2095 assessed as fractional inhibitory concentration incubated for 24 hrs in presence of ciprofloxacin by CLSI based broth dilution method2020European journal of medicinal chemistry, Oct-15, Volume: 204Antimicrobial and anti-inflammatory activities of short dodecapeptides derived from duck cathelicidin: Plausible mechanism of bactericidal action and endotoxin neutralization.
AID396224Bactericidal activity against Escherichia coli ML35 assessed as survival at 0.5 ug/ml by twofold serial dilution assay relative to control2007Antimicrobial agents and chemotherapy, Sep, Volume: 51, Issue:9
Haemophilus ducreyi is resistant to human antimicrobial peptides.
AID511697Antibacterial activity against Escherichia coli K-122010Antimicrobial agents and chemotherapy, Mar, Volume: 54, Issue:3
Identification of novel human immunodeficiency virus type 1-inhibitory peptides based on the antimicrobial peptide database.
AID762058Antibacterial activity against Escherichia coli KCTC 1682 assessed as growth inhibition after 18 to 20 hrs by broth microdilution method2013Bioorganic & medicinal chemistry letters, Aug-15, Volume: 23, Issue:16
Non hemolytic short peptidomimetics as a new class of potent and broad-spectrum antimicrobial agents.
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023]

Research

Studies (21)

TimeframeStudies, This Drug (%)All Drugs %
pre-19900 (0.00)18.7374
1990's0 (0.00)18.2507
2000's6 (28.57)29.6817
2010's13 (61.90)24.3611
2020's2 (9.52)2.80
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Study Types

Publication TypeThis drug (%)All Drugs (%)
Trials0 (0.00%)5.53%
Reviews0 (0.00%)6.00%
Case Studies0 (0.00%)4.05%
Observational0 (0.00%)0.25%
Other21 (100.00%)84.16%
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]
SubstanceRelationship StrengthStudiesTrialsClassesRoles
palmitic acid
Palmitic Acid: A common saturated fatty acid found in fats and waxes including olive oil, palm oil, and body lipids.. hexadecanoic acid : A straight-chain, sixteen-carbon, saturated long-chain fatty acid.		2.0510long-chain fatty acid;
straight-chain saturated fatty acid		algal metabolite;
Daphnia magna metabolite;
EC 1.1.1.189 (prostaglandin-E2 9-reductase) inhibitor;
plant metabolite
ciprofloxacin
Ciprofloxacin: A broad-spectrum antimicrobial carboxyfluoroquinoline.. ciprofloxacin : A quinolone that is quinolin-4(1H)-one bearing cyclopropyl, carboxylic acid, fluoro and piperazin-1-yl substituents at positions 1, 3, 6 and 7, respectively.		2.7730aminoquinoline;
cyclopropanes;
fluoroquinolone antibiotic;
N-arylpiperazine;
quinolinemonocarboxylic acid;
quinolone antibiotic;
quinolone;
zwitterion		antibacterial drug;
antiinfective agent;
antimicrobial agent;
DNA synthesis inhibitor;
EC 5.99.1.3 [DNA topoisomerase (ATP-hydrolysing)] inhibitor;
environmental contaminant;
topoisomerase IV inhibitor;
xenobiotic
nalidixic acid
[no description available]		2.5201,8-naphthyridine derivative;
monocarboxylic acid;
quinolone antibiotic		antibacterial drug;
antimicrobial agent;
DNA synthesis inhibitor
chloramphenicol
Amphenicol: Chloramphenicol and its derivatives.		2.8130C-nitro compound;
carboxamide;
diol;
organochlorine compound		antibacterial drug;
antimicrobial agent;
Escherichia coli metabolite;
geroprotector;
Mycoplasma genitalium metabolite;
protein synthesis inhibitor
cephalothin
Cephalothin: A cephalosporin antibiotic.. cefalotin : A semisynthetic, first-generation cephalosporin antibiotic with acetoxymethyl and (2-thienylacetyl)nitrilo moieties at positions 3 and 7, respectively, of the core structure. Administered parenterally during surgery and to treat a wide spectrum of blood infections.		2.0410azabicycloalkene;
beta-lactam antibiotic allergen;
carboxylic acid;
cephalosporin;
semisynthetic derivative;
thiophenes		antibacterial drug;
antimicrobial agent
kanamycin a
Kanamycin: Antibiotic complex produced by Streptomyces kanamyceticus from Japanese soil. Comprises 3 components: kanamycin A, the major component, and kanamycins B and C, the minor components.. kanamycin : Kanamycin is a naturally occurring antibiotic complex from Streptomyces kanamyceticus that consists of several components: kanamycin A, the major component (also usually designated as kanamycin), and kanamycins B, C, D and X the minor components.		2.0410kanamycinsbacterial metabolite
oxacillin
Oxacillin: An antibiotic similar to FLUCLOXACILLIN used in resistant staphylococci infections.. oxacillin : A penicillin antibiotic carrying a 5-methyl-3-phenylisoxazole-4-carboxamide group at position 6beta.		2.2110penicillinantibacterial agent;
antibacterial drug
ampicillin
Ampicillin: Semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic.. ampicillin : A penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group.		2.0410beta-lactam antibiotic;
penicillin allergen;
penicillin		antibacterial drug
gentian violet
Gentian Violet: A dye that is a mixture of violet rosanilinis with antibacterial, antifungal, and anthelmintic properties.. crystal violet : An organic chloride salt that is the monochloride salt of crystal violet cation. It has been used in creams for the topical treatment of bacterial and fungal infections, being effective against some Gram-positive bacteria (notably Staphylococcus species) and some pathogenic fungi (including Candida species) but use declined following reports of animal carcinogenicity. It has also been used for dying wood, silk, and paper, as well as a histological stain.		2.0510organic chloride saltanthelminthic drug;
antibacterial agent;
antifungal agent;
antiseptic drug;
histological dye
erythromycin
Erythromycin: A bacteriostatic antibiotic macrolide produced by Streptomyces erythreus. Erythromycin A is considered its major active component. In sensitive organisms, it inhibits protein synthesis by binding to 50S ribosomal subunits. This binding process inhibits peptidyl transferase activity and interferes with translocation of amino acids during translation and assembly of proteins.. erythromycin : Any of several wide-spectrum macrolide antibiotics obtained from actinomycete Saccharopolyspora erythraea (formerly known as Streptomyces erythraeus).. erythromycin A : An erythromycin that consists of erythronolide A having 2,6-dideoxy-3-C-methyl-3-O-methyl-alpha-L-ribo-hexopyranosyl and 3,4,6-trideoxy-3-(dimethylamino)-beta-D-xylo-hexopyranosyl residues attahced at positions 4 and 6 respectively.		2.7530cyclic ketone;
erythromycin
ethidium bromide
[no description available]		2.0510organic bromide saltgeroprotector;
intercalator;
trypanocidal drug
streptomycin
[no description available]		2.0410antibiotic antifungal drug;
antibiotic fungicide;
streptomycins		antibacterial drug;
antifungal agrochemical;
antimicrobial agent;
antimicrobial drug;
bacterial metabolite;
protein synthesis inhibitor
amoxicillin
Amoxicillin: A broad-spectrum semisynthetic antibiotic similar to AMPICILLIN except that its resistance to gastric acid permits higher serum levels with oral administration.. amoxicillin : A penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-(4-hydroxyphenyl)acetamido group.		2.0510penicillin allergen;
penicillin		antibacterial drug
zidovudine
Zidovudine: A dideoxynucleoside compound in which the 3'-hydroxy group on the sugar moiety has been replaced by an azido group. This modification prevents the formation of phosphodiester linkages which are needed for the completion of nucleic acid chains. The compound is a potent inhibitor of HIV replication, acting as a chain-terminator of viral DNA during reverse transcription. It improves immunologic function, partially reverses the HIV-induced neurological dysfunction, and improves certain other clinical abnormalities associated with AIDS. Its principal toxic effect is dose-dependent suppression of bone marrow, resulting in anemia and leukopenia.. zidovudine : A pyrimidine 2',3'-dideoxyribonucleoside compound having a 3'-azido substituent and thymine as the nucleobase.		2.0510azide;
pyrimidine 2',3'-dideoxyribonucleoside		antimetabolite;
antiviral drug;
HIV-1 reverse transcriptase inhibitor
amikacin
Amikacin: A broad-spectrum antibiotic derived from KANAMYCIN. It is reno- and oto-toxic like the other aminoglycoside antibiotics.. amikacin : An amino cyclitol glycoside that is kanamycin A acylated at the N-1 position by a 4-amino-2-hydroxybutyryl group.		2.0510alpha-D-glucoside;
amino cyclitol glycoside;
aminoglycoside;
carboxamide		antibacterial drug;
antimicrobial agent;
nephrotoxin
zithromax
Azithromycin: A semi-synthetic macrolide antibiotic structurally related to ERYTHROMYCIN. It has been used in the treatment of Mycobacterium avium intracellulare infections, toxoplasmosis, and cryptosporidiosis.. azithromycin : A macrolide antibiotic useful for the treatment of bacterial infections.		2.0510macrolide antibioticantibacterial drug;
environmental contaminant;
xenobiotic
bleomycin
[no description available]		2.4520bleomycinantineoplastic agent;
metabolite
cefuroxime
[no description available]		2.04103-(carbamoyloxymethyl)cephalosporin;
furans;
oxime O-ether		drug allergen
ceftriaxone
[no description available]		2.05101,2,4-triazines;
1,3-thiazoles;
cephalosporin;
oxime O-ether		antibacterial drug;
drug allergen;
EC 3.5.2.6 (beta-lactamase) inhibitor
cefepime
Cefepime: A fourth-generation cephalosporin antibacterial agent that is used in the treatment of infections, including those of the abdomen, urinary tract, respiratory tract, and skin. It is effective against PSEUDOMONAS AERUGINOSA and may also be used in the empiric treatment of FEBRILE NEUTROPENIA.. cefepime : A cephalosporin bearing (1-methylpyrrolidinium-1-yl)methyl and (2Z)-2-(2-amino-1,3-thiazol-4-yl)-2-(methoxyimino)acetamido groups at positions 3 and 7, respectively, of the cephem skeleton.		2.0410cephalosporin;
oxime O-ether		antibacterial drug
ceftazidime
[no description available]		2.0510cephalosporin;
oxime O-ether		antibacterial drug;
drug allergen;
EC 2.4.1.129 (peptidoglycan glycosyltransferase) inhibitor
aztreonam
[no description available]		2.0510beta-lactam antibiotic allergen;
monobactam		antibacterial drug;
drug allergen;
EC 2.4.1.129 (peptidoglycan glycosyltransferase) inhibitor
cefpodoxime
[no description available]		2.0410carboxylic acid;
cephalosporin		antibacterial drug
nitrofurantoin
Nitrofurantoin: A urinary anti-infective agent effective against most gram-positive and gram-negative organisms. Although sulfonamides and antibiotics are usually the agents of choice for urinary tract infections, nitrofurantoin is widely used for prophylaxis and long-term suppression.. nitrofurantoin : An imidazolidine-2,4-dione that is hydantoin substituted at position 1 by a [(5-nitro-2-furyl)methylene]amino group. An antibiotic that damages bacterial DNA.		2.0410imidazolidine-2,4-dione;
nitrofuran antibiotic;
organonitrogen heterocyclic antibiotic;
organooxygen heterocyclic antibiotic		antibacterial drug;
antiinfective agent;
hepatotoxic agent
polymyxin b(1)
[no description available]		2.2510
(4-24)-ply(a)
peptide-Gly-Leu-amide: 21-amino acid peptide from skin secretion of Xenopus laevis; amino acid sequence given in first source		2.0510
drosocin
drosocin: amino acid sequence given in first source for drosocin and its precursor; GenBank Z21942		2.0510
pexiganan
[no description available]		2.0510
forapin
Forapin: used as ointment for treatment of myositis & arthritis; contains bee venom, salicylate, nicotinate & vanillylnonamide		3.2650peptidyl amide;
polypeptide		animal metabolite;
antineoplastic agent;
apoptosis inducer;
EC 2.7.11.13 (protein kinase C) inhibitor;
hepatoprotective agent;
neuroprotective agent;
venom
parasin i
[no description available]		2.0510
spinigerin
spinigerin: antimicrobial peptide isolated from the fungus-growing termite Pseudacanthotermes spiniger (heterometabole insect, Isoptera); GenBank P82357		2.0510
isracidin
isracidin: the N-terminal segment (1-23) of alpha(S1)-casein B; amino acid sequence given in first source		2.0510
ceragenin csa-13
ceragenin CSA-13: has antibacterial activity; isolated from Staphylococcus aureus; structure in first source		2.0510
lycotoxin i
lycotoxin I: an antimicrobial peptide from the venom of Wolf spider, Lycosa carolinensis; amino acid sequence in first source		2.0510
melectin
melectin: isolated from the venom of the cleptoparasitic bee Melecta albifrons		2.0510
novobiocin
Novobiocin: An antibiotic compound derived from Streptomyces niveus. It has a chemical structure similar to coumarin. Novobiocin binds to DNA gyrase, and blocks adenosine triphosphatase (ATPase) activity. (From Reynolds, Martindale The Extra Pharmacopoeia, 30th ed, p189). novobiocin : A coumarin-derived antibiotic obtained from Streptomyces niveus.		2.0510carbamate ester;
ether;
hexoside;
hydroxycoumarin;
monocarboxylic acid amide;
monosaccharide derivative;
phenols		antibacterial agent;
antimicrobial agent;
EC 5.99.1.3 [DNA topoisomerase (ATP-hydrolysing)] inhibitor;
Escherichia coli metabolite;
hepatoprotective agent
tetracycline
Tetracycline: A naphthacene antibiotic that inhibits AMINO ACYL TRNA binding during protein synthesis.. tetracycline : A broad-spectrum polyketide antibiotic produced by the Streptomyces genus of actinobacteria.		2.4520
ConditionIndicatedRelationship StrengthStudiesTrials
Chancroid
Acute, localized autoinoculable infectious disease usually acquired through sexual contact. Caused by HAEMOPHILUS DUCREYI, it occurs endemically almost worldwide, especially in tropical and subtropical countries and more commonly in seaports and urban areas than in rural areas.		02.0310
Salmonella Infections, Animal
Infections in animals with bacteria of the genus SALMONELLA.		02.0410
Bacterial Disease
[description not available]		02.0510
Bacterial Infections
Infections by bacteria, general or unspecified.		02.0510
Extravascular Hemolysis
[description not available]		02.5220
Hemolysis
The destruction of ERYTHROCYTES by many different causal agents such as antibodies, bacteria, chemicals, temperature, and changes in tonicity.		02.5220
Blood Poisoning
[description not available]		02.0810
Sepsis
Systemic inflammatory response syndrome with a proven or suspected infectious etiology. When sepsis is associated with organ dysfunction distant from the site of infection, it is called severe sepsis. When sepsis is accompanied by HYPOTENSION despite adequate fluid infusion, it is called SEPTIC SHOCK.		02.0810