Page last updated: 2024-10-15

ceca1 protein, drosophila

Cross-References

ID SourceID
PubMed CID16132345
CHEMBL ID3942653
MeSH IDM0470230

Synonyms (14)

Synonym
cecropin a ,
cecropin a2 protein, drosphila
dsim protein, drosophila
dyak protein, drosophila
p9a protein
ceca1 protein, drosophila
80451-04-3
cecropin a1 protein, drosophila
ceca2 protein, drosophila
CHEMBL3942653
kwklfkkiekvgqnirdgiikagpavavvgqatqiak-nh2
DTXSID30230333
cecropin a (trifluoroacetate salt)
cecropin a (1-33), dtxsid80231193, 81541-05-1
[information is derived through text-mining from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Bioassays (1)

Assay IDTitleYearJournalArticle
AID1325282Induction of defects in chromosomal segregation in Escherichia coli SH3210 assessed as generation of anucleate cells at MIC after 2.5 hrs using beta-galactosidase substrate DDAOG by fluorescence assay2016Bioorganic & medicinal chemistry letters, 11-15, Volume: 26, Issue:22
5-Alkyloxytryptamines are membrane-targeting, broad-spectrum antibiotics.
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023]

Research

Studies (264)

TimeframeStudies, This Drug (%)All Drugs %
pre-199016 (6.06)18.7374
1990's75 (28.41)18.2507
2000's77 (29.17)29.6817
2010's78 (29.55)24.3611
2020's18 (6.82)2.80
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]

Study Types

Publication TypeThis drug (%)All Drugs (%)
Trials0 (0.00%)5.53%
Reviews16 (5.93%)6.00%
Case Studies0 (0.00%)4.05%
Observational0 (0.00%)0.25%
Other254 (94.07%)84.16%
[information is prepared from research data collected from National Library of Medicine (NLM), extracted Dec-2023]
chemdatabank.com